PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Glyma.08G095800.1.p
Common NameGLYMA_08G095800, LOC100797336
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Glycine; Soja
Family GRAS
Protein Properties Length: 518aa    MW: 57260.7 Da    PI: 5.012
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Glyma.08G095800.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS453.11.8e-1381575121374
                 GRAS   1 lvelLlecAeavssgdlelaqalLarlselaspdgdpmqRlaayfteALaarlarsvselykalppsetseknsseelaalklfsevsPi 90 
                          lv+ L++cAeav++++l+ a+al++++  la ++  +m+++a yf+eALa+r++r        + p + s    s++l++   f+e++P+
  Glyma.08G095800.1.p 157 LVHSLMACAEAVENNNLAVAEALVKQIGFLAVSQVGAMRKVAIYFAEALARRIYR--------VFPLQHS---LSDSLQI--HFYETCPY 233
                          689****************************************************........3333443...5666555..4******* PP

                 GRAS  91 lkfshltaNqaIleavegeervHiiDfdisqGlQWpaLlqaLasRpegppslRiTgvgspesgskeeleetgerLakfAeelgvpfefnv 180
                          lkf+h+taNq Ilea++g++rvH+iDf+i+qG+QWpaL+qaLa R++gpp +R+Tg+g+p++++++ l+e+g++La++Aee++v+fe++ 
  Glyma.08G095800.1.p 234 LKFAHFTANQVILEAFQGKNRVHVIDFGINQGMQWPALMQALAVRTGGPPVFRLTGIGPPAADNSDHLQEVGWKLAQLAEEINVQFEYRG 323
                          ****************************************************************************************** PP

                 GRAS 181 lvakrledleleeLrvkpgEalaVnlvlqlhrlldesvsleserdevLklvkslsPkvvvvveqeadhnsesFlerflealeyysalfds 270
                          +va++l+dl+ ++L++++gEa+aVn+v++ h+ll++++++e+    vL++v++++P++v+vveqea+hn+ sF++rf+e+l+yys+lfds
  Glyma.08G095800.1.p 324 FVANSLADLDASMLDLREGEAVAVNSVFEFHKLLARPGAVEK----VLSVVRQIRPEIVTVVEQEANHNRLSFVDRFTESLHYYSTLFDS 409
                          ******************************************....******************************************** PP

                 GRAS 271 leaklpreseerikvErellgreivnvvacegaerrerhetlekWrerleeaGFkpvplsekaakqaklllrkvk.sdgyrveeesgslv 359
                          le +  + + +++ +++++lg++i+nvvaceg +r+erhetl++Wr+r+ + GF++v+l+++a+kqa++ll+ ++ +dgyrvee++g+l+
  Glyma.08G095800.1.p 410 LEGS--PVNPNDKAMSEVYLGKQICNVVACEGMDRVERHETLNQWRNRFVSTGFSSVHLGSNAYKQASMLLALFAgGDGYRVEENNGCLM 497
                          *999..67889999999************************************************************************* PP

                 GRAS 360 lgWkdrpLvsvSaWr 374
                          lgW++rpL+++SaW+
  Glyma.08G095800.1.p 498 LGWHTRPLIATSAWQ 512
                          **************6 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS512577117No hitNo description
PfamPF120414.0E-3234100IPR021914Transcriptional factor DELLA, N-terminal
SMARTSM011293.7E-3034106No hitNo description
PROSITE profilePS5098565.968131491IPR005202Transcription factor GRAS
PfamPF035146.0E-136157512IPR005202Transcription factor GRAS
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009723Biological Processresponse to ethylene
GO:0009737Biological Processresponse to abscisic acid
GO:0009863Biological Processsalicylic acid mediated signaling pathway
GO:0009867Biological Processjasmonic acid mediated signaling pathway
GO:0009938Biological Processnegative regulation of gibberellic acid mediated signaling pathway
GO:0010187Biological Processnegative regulation of seed germination
GO:0042538Biological Processhyperosmotic salinity response
GO:2000033Biological Processregulation of seed dormancy process
GO:2000377Biological Processregulation of reactive oxygen species metabolic process
GO:0005634Cellular Componentnucleus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 518 aa     Download sequence    Send to blast
MKREREQLGS IAGTSSCGYS SGKSNLWEEE GGMDELLAVV GYKVRSSDMA EVAQKLERLE  60
EAMGNVQDDL PEISNDVVHY NPSDISNWLE TMLSNFDPLP SEEPEKDSAS SDYDLKAIPG  120
KAIYGASDAL PNPKRVKADE SRRAVVVVDS QENGIRLVHS LMACAEAVEN NNLAVAEALV  180
KQIGFLAVSQ VGAMRKVAIY FAEALARRIY RVFPLQHSLS DSLQIHFYET CPYLKFAHFT  240
ANQVILEAFQ GKNRVHVIDF GINQGMQWPA LMQALAVRTG GPPVFRLTGI GPPAADNSDH  300
LQEVGWKLAQ LAEEINVQFE YRGFVANSLA DLDASMLDLR EGEAVAVNSV FEFHKLLARP  360
GAVEKVLSVV RQIRPEIVTV VEQEANHNRL SFVDRFTESL HYYSTLFDSL EGSPVNPNDK  420
AMSEVYLGKQ ICNVVACEGM DRVERHETLN QWRNRFVSTG FSSVHLGSNA YKQASMLLAL  480
FAGGDGYRVE ENNGCLMLGW HTRPLIATSA WQLAATR*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5hyz_A9e-531575124375GRAS family transcription factor containing p
Search in ModeBase
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Gma.337530.0hypocotyl| leaf| root| seed coat
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankEU2525730.0EU252573.1 Glycine max gibberellin insensitive-like protein (GAIL) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_003531153.10.0PREDICTED: DELLA protein GAI1-like
SwissprotQ5BN220.0RGA2_BRACM; DELLA protein RGA2
TrEMBLI1KRT70.0I1KRT7_SOYBN; Uncharacterized protein
STRINGGLYMA08G10140.10.0(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF80334121
Representative plantOGRP12511550
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G14920.10.0GRAS family protein