PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Glyma.08G095300.1.p
Common NameGLYMA_08G095300, LOC102666897
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Glycine; Soja
Family M-type_MADS
Protein Properties Length: 274aa    MW: 31325.7 Da    PI: 8.8985
Description M-type_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Glyma.08G095300.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF49.84.5e-161251443
                         -SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TT CS
               SRF-TF  4 enksnrqvtfskRrngilKKAeELSvLCdaevaviifsst 43
                         +++   + tf kR++g+lKKA+E S+LC+++v vii++++
  Glyma.08G095300.1.p 12 KEEKACEKTFHKRKKGLLKKAYEFSTLCAVDVGVIIYAPK 51
                         55556667*****************************986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM004326.5E-14161IPR002100Transcription factor, MADS-box
PROSITE profilePS5006617.619151IPR002100Transcription factor, MADS-box
CDDcd002665.19E-17276No hitNo description
SuperFamilySSF554551.27E-18297IPR002100Transcription factor, MADS-box
PRINTSPR004043.7E-7323IPR002100Transcription factor, MADS-box
PfamPF003192.0E-151151IPR002100Transcription factor, MADS-box
PRINTSPR004043.7E-72338IPR002100Transcription factor, MADS-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 274 aa     Download sequence    Send to blast
MGRGRIPMEL IKEEKACEKT FHKRKKGLLK KAYEFSTLCA VDVGVIIYAP KYLNEPETWP  60
QDKDSREVKR VIQKYHNTTS DRHPKVYDVQ EYFNDRMKKI ESEISKVHKE EIKLMYPTWN  120
ESYNTLGEKQ LRMFVGILDA KLDACNQRMN MLKQDSKGKG IAKSDKIETL TPYMASNLGS  180
HLNFMSQTQL FTPSDNNQVA FYPFQLSQSS QPSTFHGGQS CVQLMEKNAM VDWANQVGVG  240
ANCDPKMGVL KEDQSNKTQN SSPCYYNGNM QTT*
Cis-element ? help Back to Top
SourceLink
PlantRegMapGlyma.08G095300.1.p
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006586360.10.0agamous-like MADS-box protein AGL8
TrEMBLI1KRT10.0I1KRT1_SOYBN; Uncharacterized protein
STRINGGLYMA08G10080.10.0(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF53431111
Representative plantOGRP3677621
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G55690.16e-23M-type_MADS family protein