PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Glyma.08G011500.4.p
Common NameGLYMA_08G011500, LOC100805328
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Glycine; Soja
Family SBP
Protein Properties Length: 397aa    MW: 43132.1 Da    PI: 8.8007
Description SBP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Glyma.08G011500.4.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SBP131.13.8e-4198174278
                          -SSTT-----TT--HHHHHTT--HHHHT-S-EEETTEEEEE-TTTSSEEETTT--SS--S-STTTT-------S--- CS
                  SBP   2 CqvegCeadlseakeyhrrhkvCevhskapvvlvsgleqrfCqqCsrfhelsefDeekrsCrrrLakhnerrrkkqa 78 
                          C v+gC++dls++++yhrrhkvCevhsk+++v++ g++qrfCqqCsrfh+l+efDe+krsCr+rL++hn+rrrk+q+
  Glyma.08G011500.4.p  98 CLVDGCHSDLSNCRDYHRRHKVCEVHSKTAQVTIGGQKQRFCQQCSRFHSLEEFDEGKRSCRKRLDGHNRRRRKPQP 174
                          **************************************************************************997 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:4.10.1100.102.3E-3391159IPR004333Transcription factor, SBP-box
PROSITE profilePS5114131.80495172IPR004333Transcription factor, SBP-box
SuperFamilySSF1036122.49E-3896177IPR004333Transcription factor, SBP-box
PfamPF031103.4E-3098171IPR004333Transcription factor, SBP-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 397 aa     Download sequence    Send to blast
MDWNLKAPSW DLSEVDQANL PNMETMEGSS RYGMYRTKGE FSVDLKLGQV GNSGRESSVL  60
TKSKDGGAVG VSKMISSSSS GSAKRARSLS NGTQTVSCLV DGCHSDLSNC RDYHRRHKVC  120
EVHSKTAQVT IGGQKQRFCQ QCSRFHSLEE FDEGKRSCRK RLDGHNRRRR KPQPEVVLTR  180
SASFLSNYHQ GTQLLSFSSS HVYPSTTVVN PTLGGVVTSG DVRLHGQNHH HHQMHLVDKQ  240
DLFLGSSPTG YKEGKHLAFM QGDHTLNNQS PHLPGASVGP AQMFLRTSPY SESGGLRCKM  300
FCDSLTGSAH GNTSRALSLL SSPPQPHSPG NGLNQMVNPH SPLMQPLGLS LHDNSLGSVD  360
PVLGPNGSDH SSSMHHIGSN GSQVNEAPPL FPFQWE*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ul4_A3e-28981711184squamosa promoter binding protein-like 4
Search in ModeBase
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1154171KRSCRKRLDGHNRRRRKP
Cis-element ? help Back to Top
SourceLink
PlantRegMapGlyma.08G011500.4.p
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006584701.10.0squamosa promoter-binding-like protein 13A isoform X2
RefseqXP_006584703.10.0squamosa promoter-binding-like protein 13A isoform X2
RefseqXP_025985259.10.0squamosa promoter-binding-like protein 13A isoform X2
RefseqXP_025985260.10.0squamosa promoter-binding-like protein 13A isoform X2
TrEMBLK7L4C40.0K7L4C4_SOYBN; Uncharacterized protein
STRINGGLYMA08G01450.10.0(Glycine max)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G50670.11e-65SBP family protein