PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Glyma.07G266500.1.p
Common NameGLYMA_07G266500, LOC100792931
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Glycine; Soja
Family GRAS
Protein Properties Length: 543aa    MW: 60329.1 Da    PI: 6.4623
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Glyma.07G266500.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS410.71.3e-1251745424374
                 GRAS   4 lLlecAeavssgdlelaqalLar.lselaspdgdpmqRlaayfteALaarlarsvselykalppsetseknsseelaalklfsevsPilk 92 
                          +L  cA+avs++d   a+  + + l +++s +gdp+qRl ay++e+L+arl +s++ +yk+l++++ +   s+e +++++++++++P+ k
  Glyma.07G266500.1.p 174 VLRVCAQAVSDDDVPTARGWMDNvLGKMVSVSGDPIQRLGAYLLEGLRARLESSGNLIYKSLNCEQPT---SKELMSYMHILYQICPYWK 260
                          6788***************997627888***************************************9...99999************** PP

                 GRAS  93 fshltaNqaIleavegeervHiiDfdisqGlQWpaLlqaLasRpegppslRiTgvgspesg..skeeleetgerLakfAeelgvpfefnv 180
                          f+++ aN  I ea+++e+r+HiiDf+i qG+QW  L+qaLa Rp+gppslR+Tgv++++s   +   l+ +gerL++fA+++gvpfef+ 
  Glyma.07G266500.1.p 261 FAYISANAVIEEAMANESRIHIIDFQIAQGTQWHLLIQALAHRPGGPPSLRVTGVDDSQSIhaRGGGLQIVGERLSDFARSCGVPFEFRS 350
                          *********************************************************9988889999*********************** PP

                 GRAS 181 lvakrledleleeLrvkpgEalaVnlvlqlhrlldesvsleserdevLklvkslsPkvvvvveqeadhnsesFlerflealeyysalfds 270
                           +a +  ++   +++v pgEalaV++ + lh+++desvs+e++rd++L+lvk+lsPkvv++veqe+++n+++F++rf+e+l+yy+a+f+s
  Glyma.07G266500.1.p 351 -AAISGCEVVRGNIEVLPGEALAVSFPYVLHHMPDESVSTENHRDRLLRLVKRLSPKVVTIVEQESNTNTSPFFHRFVETLDYYTAMFES 439
                          .56666677799****************************************************************************** PP

                 GRAS 271 leaklpreseerikvErellgreivnvvacegaerrerhetlekWrerleeaGFkpvplsekaakqaklllrkvksdgyrveeesgslvl 360
                          +++  pr++++ri+ E+++++r+ivn++aceg er+erhe l+kWr+rl++aGFk+ +ls++++  ++ ll++++++ yr+e+++g+l+l
  Glyma.07G266500.1.p 440 IDVACPRDDKKRISAEQHCVARDIVNMIACEGVERVERHELLGKWRSRLSMAGFKQCQLSSSVMVAIQNLLKEFSQN-YRLEHRDGALYL 528
                          ***************************************************************************66.************ PP

                 GRAS 361 gWkdrpLvsvSaWr 374
                          gW++r + + SaWr
  Glyma.07G266500.1.p 529 GWMNRHMATSSAWR 542
                          *************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5098564.077145523IPR005202Transcription factor GRAS
PfamPF035144.6E-123174542IPR005202Transcription factor GRAS
Gene3DG3DSA:3.40.50.1502.1E-4307499IPR029063S-adenosyl-L-methionine-dependent methyltransferase
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 543 aa     Download sequence    Send to blast
MQTSQKHPSS AGVHFYHQPV QGIYQMLQSN LCHDSSSQGT SVSFETCKEQ YFTLESCPAP  60
TTCFVDCDDS PSYASVSSKR TPFSPQGSQS CYSDHQQSSD NTYGSPISGL SSVDDGHELK  120
HKLRELEISL LGPEQSDSCG CCVVKGGLQG SSQLAKHNWD QIAENVAQFD LKGVLRVCAQ  180
AVSDDDVPTA RGWMDNVLGK MVSVSGDPIQ RLGAYLLEGL RARLESSGNL IYKSLNCEQP  240
TSKELMSYMH ILYQICPYWK FAYISANAVI EEAMANESRI HIIDFQIAQG TQWHLLIQAL  300
AHRPGGPPSL RVTGVDDSQS IHARGGGLQI VGERLSDFAR SCGVPFEFRS AAISGCEVVR  360
GNIEVLPGEA LAVSFPYVLH HMPDESVSTE NHRDRLLRLV KRLSPKVVTI VEQESNTNTS  420
PFFHRFVETL DYYTAMFESI DVACPRDDKK RISAEQHCVA RDIVNMIACE GVERVERHEL  480
LGKWRSRLSM AGFKQCQLSS SVMVAIQNLL KEFSQNYRLE HRDGALYLGW MNRHMATSSA  540
WR*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5hyz_A7e-5520554236375GRAS family transcription factor containing p
Search in ModeBase
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Gma.275380.0flower| leaf| meristem| pod| root| seed coat
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankBT0977040.0BT097704.1 Soybean clone JCVI-FLGm-22M20 unknown mRNA.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqNP_001240165.10.0uncharacterized protein LOC100792931
RefseqXP_014632837.10.0PREDICTED: uncharacterized protein LOC100792931 isoform X1
SwissprotQ9M0M50.0SCL13_ARATH; Scarecrow-like protein 13
TrEMBLC6TJ610.0C6TJ61_SOYBN; Uncharacterized protein
STRINGGLYMA07G39650.30.0(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP14091447
FabidsOGEF43773360
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G17230.10.0SCARECROW-like 13