PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Glyma.07G234200.1.p
Common NameGLYMA_07G234200, LOC100780152
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Glycine; Soja
Family SBP
Protein Properties Length: 1040aa    MW: 114832 Da    PI: 7.5053
Description SBP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Glyma.07G234200.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SBP128.52.5e-40161238178
                          --SSTT-----TT--HHHHHTT--HHHHT-S-EEETTEEEEE-TTTSSEEETTT--SS--S-STTTT-------S--- CS
                  SBP   1 lCqvegCeadlseakeyhrrhkvCevhskapvvlvsgleqrfCqqCsrfhelsefDeekrsCrrrLakhnerrrkkqa 78 
                          +Cqv++C+adls+ak+yhrrhkvC+vhska+++lv +++qrfCqqCsrfh l+efDe+krsCrrrLa+hn+rrrk+++
  Glyma.07G234200.1.p 161 VCQVQDCRADLSNAKDYHRRHKVCDVHSKATMALVGNVMQRFCQQCSRFHVLQEFDEGKRSCRRRLAGHNRRRRKTHP 238
                          6**************************************************************************976 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:4.10.1100.109.4E-32156223IPR004333Transcription factor, SBP-box
PROSITE profilePS5114131.966159236IPR004333Transcription factor, SBP-box
SuperFamilySSF1036122.22E-37160241IPR004333Transcription factor, SBP-box
PfamPF031107.7E-29162235IPR004333Transcription factor, SBP-box
Gene3DG3DSA:1.25.40.201.8E-6278302IPR020683Ankyrin repeat-containing domain
SuperFamilySSF484031.38E-6804924IPR020683Ankyrin repeat-containing domain
CDDcd002047.33E-7811921No hitNo description
Gene3DG3DSA:1.25.40.201.8E-6811922IPR020683Ankyrin repeat-containing domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005634Cellular Componentnucleus
GO:0016021Cellular Componentintegral component of membrane
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 1040 aa     Download sequence    Send to blast
MEAEFGGKNQ YLYGPVVSGM KKAVVGNGKR SLEWDLNDWR WDGDLFTAQP LNSVPSDCRG  60
CQFFPPHPEI PAKNANPSTT NLSSSVFILG EGKRELEKRR RDVIAEGEGE GLNDEGGSLS  120
LNLGGQGYPL MLEEEEKSGK KTKVIGTNTT TTTTTTSNRA VCQVQDCRAD LSNAKDYHRR  180
HKVCDVHSKA TMALVGNVMQ RFCQQCSRFH VLQEFDEGKR SCRRRLAGHN RRRRKTHPDV  240
SVVNEGSLND QRDSNYLLMS LLRILTNLHS NGSDHTRNQD ILSHLLKNLA SLAGPNNGGR  300
LAPLLEESKG LVNAGTHGAD HDKPNLNSNA PEASRPSSSI KTDNGIIAQD PPMSVVQYET  360
PANGMTQKCI ASGDGVGNLK PPSGPLLSNV CEPRDSVPSQ LTTAETKVGR GNLNNIDLNN  420
VYNDIQNTVE NHKKPYPPVA SGMGFIDHAS WLQCDSLKSS PPQTSRNSDS TSTQSPSSSS  480
GEAQSRTDRI VFKLFGKDPS DFPLLLRSQI LNWLSRSPTE IESYIRPGCI ILTIYLRLEK  540
SAWEELYCNL GSSLRKLLAA SNDSFWRTGW VYARVQHAVA FLYNGQVVLD VPLRLKSPQH  600
CMISCINPLA VPASASAQFI VKGFNLSQSS TRLHCALEGK YLVHASCHDL IGGADAPIQH  660
LSFSCQIPSV TGRGFIEVED HGLSSCSFPF IVAEQEVCSE ICKLENVIEE AETTDDIQIK  720
NQHMEEKTQA LDFLQEMGWL LHRSHVKFKL GSMAPFHDLF QFNRFAWLVD FSMDHGWCAV  780
MKKLLDIIFE GGVDAGEHAS IELALLNMGL LHRAVKRNCR PMVELLLRFV PVKTSDGADS  840
EMKQVAEAPD RFLFRPDTVG PAGLTPLHVA ASMSGSENVL DALTNDPRMV GIEAWKSARD  900
STGLTPNDHA CLRGYYSYIQ LVQNKTNKKG ERQHLVDIPG TVVDSNTTQK QSDGNRTCRV  960
PSLKTEKIET TAMPRQCRAC QQKVAYGGMK TAMVYRPVML SMVTIAVVCV CVALLFKSSP  1020
RVYYVFQPFN WESLEYGAM*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ul4_A7e-30153235284squamosa promoter binding protein-like 4
Search in ModeBase
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Gma.274390.0flower| meristem| pod| root| seed coat| stem
Cis-element ? help Back to Top
SourceLink
PlantRegMapGlyma.07G234200.1.p
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_003528599.10.0squamosa promoter-binding-like protein 1
TrEMBLA0A0B2R7Q00.0A0A0B2R7Q0_GLYSO; Squamosa promoter-binding-like protein 1
TrEMBLK7L3G60.0K7L3G6_SOYBN; Uncharacterized protein
STRINGGLYMA07G36180.30.0(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF15393495
Representative plantOGRP25951432
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G47070.10.0squamosa promoter binding protein-like 1