PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Glyma.07G229600.1.p
Common NameGLYMA_07G229600, LOC100813315
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Glycine; Soja
Family Dof
Protein Properties Length: 480aa    MW: 51885.3 Da    PI: 7.2579
Description Dof family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Glyma.07G229600.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-Dof124.53.4e-39127185260
               zf-Dof   2 kekalkcprCdstntkfCyynnyslsqPryfCkaCrryWtkGGalrnvPvGggrrknkk 60 
                          ++k l+cprC+s++tkfCyynny+++qPr+fCk+C+ryWt+GG++rnvPvG+grrknk+
  Glyma.07G229600.1.p 127 PDKVLPCPRCNSMDTKFCYYNNYNVNQPRHFCKNCQRYWTAGGTMRNVPVGAGRRKNKN 185
                          78999****************************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
ProDomPD0074785.0E-31125184IPR003851Zinc finger, Dof-type
PfamPF027014.3E-32128185IPR003851Zinc finger, Dof-type
PROSITE profilePS5088428.975131185IPR003851Zinc finger, Dof-type
PROSITE patternPS013610133169IPR003851Zinc finger, Dof-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 480 aa     Download sequence    Send to blast
MSEVKDPAIK LFGRTISLTH THINDSSSSS APARAPSSSS SPREVTSSAT QQQHEPEEPS  60
RKELTSSQDD DGSHQTTEDL KSPTTSSGIF ENPKTPSPET ETSVPKSSTN GEQSETSASD  120
EKTPKKPDKV LPCPRCNSMD TKFCYYNNYN VNQPRHFCKN CQRYWTAGGT MRNVPVGAGR  180
RKNKNFPATA SHYRHLMFPE GLQGATLNAP NGLHNAVLGN GAAVLTFGPD SPLCDTMASM  240
LNIAERAQSC VPNGFQATEP NSFVSYRKEE DGSTSGHSTG VSVATTSTSS HSGSHESVDK  300
RVEGFTPQLP YFPSGPWPYP MPPPTFCPPG YPLSFYTTPA YWGCMPPSWN NNISSISPQS  360
SVNNSVSVLT LGKHSRDGNI IAPSNSQREM HDMEHKSSEH NVLIPKTLRI DDPSEAAKSS  420
ISMWSKLGIK DDKAGSGGLF KAFPSSKGND MNHHMVEASP LLQANPAALS RSLTFREQT*
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Gma.210120.0cotyledon| seed coat
Cis-element ? help Back to Top
SourceLink
PlantRegMapGlyma.07G229600.1.p
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_003528583.10.0cyclic dof factor 2 isoform X1
RefseqXP_028241473.10.0cyclic dof factor 2-like
TrEMBLA0A0B2R3A50.0A0A0B2R3A5_GLYSO; Cyclic dof factor 2 isoform A
TrEMBLI1KMH10.0I1KMH1_SOYBN; Uncharacterized protein
STRINGGLYMA07G35690.10.0(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF62534147
Representative plantOGRP3817445
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G39660.21e-52cycling DOF factor 2