PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Glyma.07G218000.1.p
Common NameGLYMA_07G218000, LOC100775341
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Glycine; Soja
Family HD-ZIP
Protein Properties Length: 214aa    MW: 23956.3 Da    PI: 8.4965
Description HD-ZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Glyma.07G218000.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox61.61.2e-1964118256
                          T--SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHH CS
             Homeobox   2 rkRttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakek 56 
                          rk+ ++tkeq + Lee F++n++++ +++e LA++l+L  rqV vWFqNrRa+ k
  Glyma.07G218000.1.p  64 RKKLRLTKEQSRLLEESFRQNHTLNPKQKESLAMQLKLRPRQVEVWFQNRRARSK 118
                          78889************************************************98 PP

2HD-ZIP_I/II1192.6e-3864152190
          HD-ZIP_I/II   1 ekkrrlskeqvklLEesFeeeekLeperKvelareLglqprqvavWFqnrRARtktkqlEkdyeaLkraydalkeenerLekeveeLree 90 
                          +kk+rl+keq++lLEesF+++++L+p++K++la +L+l+prqv+vWFqnrRAR k+kq+E+++e+Lkr++ +l+e+n+rL++eveeLr +
  Glyma.07G218000.1.p  64 RKKLRLTKEQSRLLEESFRQNHTLNPKQKESLAMQLKLRPRQVEVWFQNRRARSKLKQTEMECEYLKRWFGSLTEQNRRLQREVEELR-A 152
                          69*************************************************************************************9.4 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.605.4E-1946118IPR009057Homeodomain-like
SuperFamilySSF466892.35E-1949121IPR009057Homeodomain-like
PROSITE profilePS5007117.68660120IPR001356Homeobox domain
SMARTSM003897.6E-1862124IPR001356Homeobox domain
CDDcd000862.56E-1663121No hitNo description
PfamPF000465.3E-1764118IPR001356Homeobox domain
PROSITE patternPS00027095118IPR017970Homeobox, conserved site
SMARTSM003401.4E-21120163IPR003106Leucine zipper, homeobox-associated
PfamPF021831.4E-9120153IPR003106Leucine zipper, homeobox-associated
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 214 aa     Download sequence    Send to blast
MAVLPSSSSS LELTISVPGF ASSPTLLPSS SVKELDINQV PLEEDWMASN MEDEEESSNG  60
EPPRKKLRLT KEQSRLLEES FRQNHTLNPK QKESLAMQLK LRPRQVEVWF QNRRARSKLK  120
QTEMECEYLK RWFGSLTEQN RRLQREVEEL RAIKVGPPTV ISPHSCEPLP ASTLSMCPRC  180
ERVTSTADKP PSAAATLSAK VPPTQSRQPS AAC*
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1112120RRARSKLKQ
Expression -- Description ? help Back to Top
Source Description
UniprotTISSUE SPECIFICITY: Expressed in seedlings, roots, leaves, nodes, internodes, flowers and embryo. {ECO:0000269|PubMed:10732669, ECO:0000269|PubMed:17999151}.
UniprotTISSUE SPECIFICITY: Expressed in seedlings, roots, leaves, nodes, internodes, flowers and embryo. {ECO:0000269|PubMed:10732669, ECO:0000269|PubMed:17999151}.
Functional Description ? help Back to Top
Source Description
UniProtProbable transcription factor. {ECO:0000250}.
UniProtProbable transcription repressor that binds to the DNA sequence 5'-CAAT[GC]ATTG-3'. {ECO:0000269|PubMed:10732669}.
UniProtProbable transcription repressor that binds to the DNA sequence 5'-CAAT[GC]ATTG-3'. {ECO:0000269|PubMed:10732669}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapGlyma.07G218000.1.p
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_003528535.11e-152homeobox-leucine zipper protein HOX3 isoform X3
RefseqXP_028241317.11e-152homeobox-leucine zipper protein HOX3-like isoform X2
SwissprotQ0JKX11e-80HOX3_ORYSJ; Homeobox-leucine zipper protein HOX3
SwissprotQ8S9N64e-80ATB17_ARATH; Homeobox-leucine zipper protein ATHB-17
SwissprotQ9XH381e-80HOX3_ORYSI; Homeobox-leucine zipper protein HOX3
TrEMBLA0A445JZY81e-151A0A445JZY8_GLYSO; Homeobox-leucine zipper protein HOX3 isoform A
TrEMBLI1KM501e-151I1KM50_SOYBN; Uncharacterized protein
STRINGGLYMA07G34230.11e-151(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF95063040
Representative plantOGRP19616156
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G01430.12e-80homeobox-leucine zipper protein 17
Publications ? help Back to Top
  1. Zhao P, et al.
    ATHB17 enhances stress tolerance by coordinating photosynthesis associated nuclear gene and ATSIG5 expression in response to abiotic stress.
    Sci Rep, 2017. 7: p. 45492
    [PMID:28358040]