PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Glyma.07G199000.1.p
Common NameGLYMA_07G199000
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Glycine; Soja
Family SBP
Protein Properties Length: 147aa    MW: 17020.7 Da    PI: 7.5348
Description SBP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Glyma.07G199000.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SBP137.73.4e-4365140277
                          -SSTT-----TT--HHHHHTT--HHHHT-S-EEETTEEEEE-TTTSSEEETTT--SS--S-STTTT-------S-- CS
                  SBP   2 CqvegCeadlseakeyhrrhkvCevhskapvvlvsgleqrfCqqCsrfhelsefDeekrsCrrrLakhnerrrkkq 77 
                          Cqv++C+adlseak+yhrrhkvCe h+kap+v ++gl+qrfCqqCsrfhelsefD++krsCr+rLa+hnerrrk++
  Glyma.07G199000.1.p  65 CQVDNCDADLSEAKQYHRRHKVCEYHAKAPSVHMAGLQQRFCQQCSRFHELSEFDDSKRSCRTRLAGHNERRRKNA 140
                          **************************************************************************87 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PIRSFPIRSF0375752.2E-564146IPR017238Squamosa promoter-binding protein
Gene3DG3DSA:4.10.1100.104.8E-3757126IPR004333Transcription factor, SBP-box
PROSITE profilePS5114132.34262139IPR004333Transcription factor, SBP-box
SuperFamilySSF1036121.47E-3963143IPR004333Transcription factor, SBP-box
PfamPF031102.3E-3465138IPR004333Transcription factor, SBP-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009908Biological Processflower development
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0046872Molecular Functionmetal ion binding
Sequence ? help Back to Top
Protein Sequence    Length: 147 aa     Download sequence    Send to blast
MDTSRYEGKR VLRYKEEDEN DDDEEEEEVS EVGFGADRRR NKRVMRDLHG KRSGSKGGGS  60
MPPSCQVDNC DADLSEAKQY HRRHKVCEYH AKAPSVHMAG LQQRFCQQCS RFHELSEFDD  120
SKRSCRTRLA GHNERRRKNA VDYHGE*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ul4_A1e-3754138184squamosa promoter binding protein-like 4
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtProbable transcriptional factor. Binds to the promoter of the SQUAMOSA gene.
Cis-element ? help Back to Top
SourceLink
PlantRegMapGlyma.07G199000.1.p
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankBT0967260.0BT096726.1 Soybean clone JCVI-FLGm-15P19 unknown mRNA.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_025984849.11e-104uncharacterized protein LOC100789055 isoform X1
SwissprotQ387414e-48SBP1_ANTMA; Squamosa promoter-binding protein 1
TrEMBLI1KLM61e-103I1KLM6_SOYBN; Squamosa promoter-binding-like protein
STRINGGLYMA07G31880.11e-104(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF53534153
Representative plantOGRP9717230
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G33810.12e-41squamosa promoter binding protein-like 3
Publications ? help Back to Top
  1. Klein J,Saedler H,Huijser P
    A new family of DNA binding proteins includes putative transcriptional regulators of the Antirrhinum majus floral meristem identity gene SQUAMOSA.
    Mol. Gen. Genet., 1996. 250(1): p. 7-16
    [PMID:8569690]