PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Glyma.07G198900.1.p
Common NameGLYMA_07G198900, LOC778101
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Glycine; Soja
Family Dof
Protein Properties Length: 349aa    MW: 37457.3 Da    PI: 9.0834
Description Dof family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Glyma.07G198900.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-Dof125.41.7e-3949109262
               zf-Dof   2 kekalkcprCdstntkfCyynnyslsqPryfCkaCrryWtkGGalrnvPvGggrrknkkss 62 
                          +++alkcprCds+ntkfCyynnyslsqPr+fCkaC+ryWt+GG+lrnvPvGgg+rknk+++
  Glyma.07G198900.1.p  49 QQQALKCPRCDSSNTKFCYYNNYSLSQPRHFCKACKRYWTRGGTLRNVPVGGGCRKNKRMK 109
                          7899******************************************************976 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF027019.0E-3451107IPR003851Zinc finger, Dof-type
PROSITE profilePS5088429.52553107IPR003851Zinc finger, Dof-type
ProDomPD0074783.0E-2654107IPR003851Zinc finger, Dof-type
PROSITE patternPS0136105591IPR003851Zinc finger, Dof-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 349 aa     Download sequence    Send to blast
MFGGKCEKMV AVTPQTASNK WTQTQQIDDH KAPMGRIMEK PSQDLLQQQQ QALKCPRCDS  60
SNTKFCYYNN YSLSQPRHFC KACKRYWTRG GTLRNVPVGG GCRKNKRMKR PTNGDSSSAN  120
SPSSSTPSAS SNPPSQPHID NIIVSGSATN HINNINPLFY GGDVMNNVPF PKFNLLQSQL  180
NALGLGFSSG VRENGFSTTS NNNFFSAYNS IFGSSSSSTC APSTPVMASL LSSTLLQQNF  240
MGGGGGGVKG RDHDQGDNTF HGLAPLQGLR VEGDSNNNIG SKEVKGEGQN RFEWSNNNNN  300
NNNNGGGGQN QMEHVGLSDP NSLYWNTATG LGAWSDQPNI GPSVTSLI*
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Gma.286750.0epicotyl| hypocotyl
Cis-element ? help Back to Top
SourceLink
PlantRegMapGlyma.07G198900.1.p
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankBT0940370.0BT094037.1 Soybean clone JCVI-FLGm-14M14 unknown mRNA.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006583829.10.0dof zinc finger protein DOF1.4 isoform X1
RefseqXP_028241073.10.0dof zinc finger protein DOF1.4-like isoform X1
TrEMBLA0A0B2Q8E30.0A0A0B2Q8E3_GLYSO; Dof zinc finger protein DOF1.4
TrEMBLK7L2R40.0K7L2R4_SOYBN; Uncharacterized protein
STRINGGLYMA07G31870.20.0(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF45223356
Representative plantOGRP3817445
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G28310.24e-35Dof family protein