PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Glyma.07G198800.1.p
Common NameGLYMA_07G198800, LOC100814555
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Glycine; Soja
Family Dof
Protein Properties Length: 289aa    MW: 31399.8 Da    PI: 10.7176
Description Dof family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Glyma.07G198800.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-Dof117.93.8e-372482260
               zf-Dof  2 kekalkcprCdstntkfCyynnyslsqPryfCkaCrryWtkGGalrnvPvGggrrknkk 60
                         +++++kcprC s+ntkfCy+nnyslsqPr+fCk+C+ryWt+GG++rn+PvGgg+rk k+
  Glyma.07G198800.1.p 24 PQQHQKCPRCGSMNTKFCYFNNYSLSQPRHFCKTCKRYWTHGGTFRNIPVGGGSRKVKR 82
                         68899***************************************************987 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
ProDomPD0074781.0E-181872IPR003851Zinc finger, Dof-type
PfamPF027014.6E-322682IPR003851Zinc finger, Dof-type
PROSITE profilePS5088427.9872882IPR003851Zinc finger, Dof-type
PROSITE patternPS0136103066IPR003851Zinc finger, Dof-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 289 aa     Download sequence    Send to blast
MEQEGEKGRE ERRQVQRAAT QQPPQQHQKC PRCGSMNTKF CYFNNYSLSQ PRHFCKTCKR  60
YWTHGGTFRN IPVGGGSRKV KRGKTNSSSF SSSSSSSSNL LTQPQQNLLM RPSPPLITTM  120
VQSTSPYYHL AGGSGYLSSL ATLHSLNNNT SQPFNQYLKV GGDFAGSSNS PLVSGFNAAY  180
SLPPRFPQQQ SMYPAQQQQQ QQQRLIPSNM ASSGAVSHSA LRTQSLINNV STSTNHRASI  240
SDASLWSAAT VNTTSIGGNS DQNNVVKGGS SSLVPSHWLH RPGFGPPQ*
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Gma.286761e-158root
Cis-element ? help Back to Top
SourceLink
PlantRegMapGlyma.07G198800.1.p
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankDQ8572591e-155DQ857259.1 Glycine max Dof9 mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_014633048.10.0dof zinc finger protein DOF2.2
RefseqXP_028241071.10.0dof zinc finger protein DOF2.2-like
TrEMBLA0A0B2Q9140.0A0A0B2Q914_GLYSO; Dof zinc finger protein DOF5.3
TrEMBLK7L2R30.0K7L2R3_SOYBN; Uncharacterized protein
STRINGGLYMA07G31860.20.0(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF41453258
Representative plantOGRP3817445
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G51700.11e-24DOF zinc finger protein 1