PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Glyma.07G193900.1.p
Common NameGLYMA_07G193900, LOC100818111
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Glycine; Soja
Family Dof
Protein Properties Length: 333aa    MW: 36557.7 Da    PI: 8.5551
Description Dof family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Glyma.07G193900.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-Dof113.21.2e-3551109361
               zf-Dof   3 ekalkcprCdstntkfCyynnyslsqPryfCkaCrryWtkGGalrnvPvGggrrknkks 61 
                          +++lkcprCdstntkfCyynny+ sqPr+fC+aC+r+WtkGG+lrnvPvGggr++++ +
  Glyma.07G193900.1.p  51 SESLKCPRCDSTNTKFCYYNNYNKSQPRHFCRACKRHWTKGGTLRNVPVGGGRKNKRVK 109
                          5789***********************************************97766544 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
ProDomPD0074789.0E-204998IPR003851Zinc finger, Dof-type
PfamPF027011.4E-3153106IPR003851Zinc finger, Dof-type
PROSITE profilePS5088427.46554108IPR003851Zinc finger, Dof-type
PROSITE patternPS0136105692IPR003851Zinc finger, Dof-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 333 aa     Download sequence    Send to blast
MGLSSKQVSS SGLDWKQTLL EAQNLELPKP NLMRKQQQQQ QQQQQQTQPN SESLKCPRCD  60
STNTKFCYYN NYNKSQPRHF CRACKRHWTK GGTLRNVPVG GGRKNKRVKK SITPITTSST  120
TTTPITTATS TCTATVTTSI GNNMDAMLGC YSHMTIQTPL ADDQKNMSSS LYQALIRPPP  180
LLLQQNLLNT RELEGKDFGI GIGNNGIFPS STLALPTHQS QSLLFPFSAS SRSFDTNPCS  240
VVSTSLRSSN VYNYGEDQFK AIEEPTINST TATIVPSTGG TNNTHHPWEI AAATSGVGLG  300
TSSNSNYWNW EDFDSLVSTD LKDPWDDSDI KP*
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Gma.621370.0cotyledon| stem
Cis-element ? help Back to Top
SourceLink
PlantRegMapGlyma.07G193900.1.p
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_003529308.10.0dof zinc finger protein DOF3.2
RefseqXP_028241001.10.0dof zinc finger protein DOF3.2-like
TrEMBLA0A0B2PIC30.0A0A0B2PIC3_GLYSO; Dof zinc finger protein 4 isoform A
TrEMBLI1KLH30.0I1KLH3_SOYBN; Uncharacterized protein
STRINGGLYMA07G31340.10.0(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF51073356
Representative plantOGRP3817445
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G51700.15e-26DOF zinc finger protein 1