PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Glyma.07G159300.2.p
Common NameGLYMA_07G159300, LOC100819004
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Glycine; Soja
Family SBP
Protein Properties Length: 993aa    MW: 109566 Da    PI: 7.963
Description SBP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Glyma.07G159300.2.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SBP129.11.7e-40102179178
                          --SSTT-----TT--HHHHHTT--HHHHT-S-EEETTEEEEE-TTTSSEEETTT--SS--S-STTTT-------S--- CS
                  SBP   1 lCqvegCeadlseakeyhrrhkvCevhskapvvlvsgleqrfCqqCsrfhelsefDeekrsCrrrLakhnerrrkkqa 78 
                          +Cqv++C++dls+ak+yhrrhkvCe+hska+++l+++++qrfCqqCsrfh lsefDe+krsCrrrLa+hn+rrrk+q+
  Glyma.07G159300.2.p 102 MCQVDNCREDLSKAKDYHRRHKVCEAHSKASKALLANQMQRFCQQCSRFHPLSEFDEGKRSCRRRLAGHNRRRRKTQP 179
                          6**************************************************************************997 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:4.10.1100.102.9E-3497164IPR004333Transcription factor, SBP-box
PROSITE profilePS5114131.889100177IPR004333Transcription factor, SBP-box
SuperFamilySSF1036122.09E-37101181IPR004333Transcription factor, SBP-box
PfamPF031108.9E-30103176IPR004333Transcription factor, SBP-box
Gene3DG3DSA:1.25.40.206.8E-4200235IPR020683Ankyrin repeat-containing domain
SuperFamilySSF484031.95E-5739887IPR020683Ankyrin repeat-containing domain
Gene3DG3DSA:1.25.40.206.8E-4783889IPR020683Ankyrin repeat-containing domain
CDDcd002045.06E-4786885No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005634Cellular Componentnucleus
GO:0016021Cellular Componentintegral component of membrane
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 993 aa     Download sequence    Send to blast
MEKVAPPPIL MHRKRDLSYD IVSAGPNESW RWEWDSVRFA GKPPPPPPLS PNNDVVFEAE  60
SVVPPLQLKL GGTTRVNNNN ININVSNKRV RSGSPGTASY PMCQVDNCRE DLSKAKDYHR  120
RHKVCEAHSK ASKALLANQM QRFCQQCSRF HPLSEFDEGK RSCRRRLAGH NRRRRKTQPE  180
DVTSATPAPA AAANLEIFNL LTAIAGASQD LATKLLDAGS GNVNGKKDHV QLQTPSSSYQ  240
CHESHDLLNH TPAAPLTMDL LAVLSTTLSG GSAPDSSASP SQNRSCSSDG GSADQTRQQQ  300
FFSVGGERSS SSSQSPVEDS DCQEVRVNLP LQLFSSSPED DSLPKLASSR KYFSSDSSNP  360
AEERSPSSSP PIVEMQFDLQ DGARGLKPES ISSGRGVNAN KEASQSHSSN ISLDLFKGSN  420
NWIQQPSSLQ SVPFQAGYTS SGSDHSPPSL NSDAQDRTGR IMFKLFDKHP SHFPGTLRAQ  480
IYNWLSNRPS DMESYIRPGC VVLSIYASMS SADWERLEEN FLQHVHSLIQ NSDSDFWRNG  540
RFLVHSGSRL VSHKDGKIRI CKPWRTWKSP ELISVSPLAI VSGQETSISL KGRNLSTLGT  600
KIHCTGTGSY ASAEVIGSAH SGVMYDKIKL SGFKVQDVSP GVLGRCFIEV ENGFKGNSFP  660
VIIADETICK ELRPLESEFD EEEKICDAIS EEHEHHFGRP RSREEALHFL NELGWLFQRE  720
RFSYVHEVPC YSLDRFKFVL IFAVERNCCM LIKTLLDVLV GKHLQGEWLS TGSVEMLNAI  780
QLLNRAVKGK YVGMVDLLIH YSIPSKNGTS RKYVFPPNLE GPGGITPLHL AACTSGSESV  840
VDSLTSDPQE IGLKCWESLV DANGQSPHAY AMMRNNDSYN ALVARKLADR QRGEISVTIA  900
NAIEQQSLRV ELKQKQSYLV KRGQSSCAKC ANAEIRYNRR VPGSHGLLHR PFIYSMLAVA  960
AVCVCVCVFF RGRPFVGSVA PFSWENLDYG TM*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ul4_A2e-3293176184squamosa promoter binding protein-like 4
Search in ModeBase
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Gma.143170.0leaf| meristem| root
Expression -- Description ? help Back to Top
Source Description
UniprotTISSUE SPECIFICITY: Expressed in vasculature of aerial parts. Expressed in cotyledons and leaf petioles. {ECO:0000269|PubMed:15703061}.
Functional Description ? help Back to Top
Source Description
UniProtTrans-acting factor that binds specifically to the consensus nucleotide sequence 5'-TNCGTACAA-3' (By similarity). May play a role in plant development. {ECO:0000250, ECO:0000269|PubMed:15703061}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapGlyma.07G159300.2.p
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAC2353300.0AC235330.1 Glycine max strain Williams 82 clone GM_WBb0082G12, complete sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006583697.10.0squamosa promoter-binding-like protein 14 isoform X2
RefseqXP_028240598.10.0squamosa promoter-binding-like protein 14 isoform X2
SwissprotQ8RY950.0SPL14_ARATH; Squamosa promoter-binding-like protein 14
TrEMBLA0A445JXC10.0A0A445JXC1_GLYSO; Squamosa promoter-binding-like protein 14 isoform B
TrEMBLK7L2140.0K7L214_SOYBN; Uncharacterized protein
STRINGGLYMA07G19770.10.0(Glycine max)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G20980.10.0squamosa promoter binding protein-like 14
Publications ? help Back to Top
  1. Jorgensen SA,Preston JC
    Differential SPL gene expression patterns reveal candidate genes underlying flowering time and architectural differences in Mimulus and Arabidopsis.
    Mol. Phylogenet. Evol., 2014. 73: p. 129-39
    [PMID:24508602]
  2. Liu J, et al.
    Characterizing Variation of Branch Angle and Genome-Wide Association Mapping in Rapeseed (Brassica napus L.).
    Front Plant Sci, 2016. 7: p. 21
    [PMID:26870051]