PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Glyma.07G151100.1.p
Common NameGLYMA_07G151100, LOC100778195
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Glycine; Soja
Family Trihelix
Protein Properties Length: 292aa    MW: 35078.4 Da    PI: 7.591
Description Trihelix family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Glyma.07G151100.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1trihelix803.5e-2549131186
             trihelix   1 rWtkqevlaLiearremeerlrrgklkkplWeevskkmrergferspkqCkekwenlnkrykkikegekkrtsessstcpyfdqle 86 
                          +W+ qe+++ + +r e+++++ ++k++k+lWe +s +m+e+gf++s++qCk+kw+nl +ryk ++++e +    +++++p++++l+
  Glyma.07G151100.1.p  49 QWSIQETKEFLMIRAELDQTFMDTKRNKQLWEVISTRMKEKGFHKSAEQCKCKWKNLVTRYKGCETMEPEA---TRQQFPFYNELQ 131
                          7********************************************************************96...45679*****98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
CDDcd122034.48E-2148113No hitNo description
PfamPF138371.3E-2049133No hitNo description
PROSITE profilePS500907.00450106IPR017877Myb-like domain
Sequence ? help Back to Top
Protein Sequence    Length: 292 aa     Download sequence    Send to blast
MEGHHLHHHH RQQQQQHHHQ QQHQQQQHHH HPHHNITTSN VDATDRFPQW SIQETKEFLM  60
IRAELDQTFM DTKRNKQLWE VISTRMKEKG FHKSAEQCKC KWKNLVTRYK GCETMEPEAT  120
RQQFPFYNEL QAIFAARMQR MLWAEAEGGS NKKKVHLSSE DEEEGNEETS EGDHKGNITS  180
KKKKKGKMVI GGGGSGNNNL ESLKEIMDEF MRQQMQMEAQ WMEAFEAREN ERRLKEMEWR  240
QTMEALENER LMMDQRWRER EEQRRIREEV RADKRDALIT ALLNKLRREE M*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAP0150371e-144AP015037.1 Vigna angularis var. angularis DNA, chromosome 4, almost complete sequence, cultivar: Shumari.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006583658.10.0PREDICTED: trihelix transcription factor GT-3b-like
SwissprotQ9SDW01e-70TGT3A_ARATH; Trihelix transcription factor GT-3a
TrEMBLI1KKF80.0I1KKF8_SOYBN; Uncharacterized protein
STRINGGLYMA07G18320.10.0(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF17813385
Representative plantOGRP22621535
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G01380.12e-54Trihelix family protein