PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Glyma.07G133100.1.p
Common NameGLYMA_07G133100, LOC100807788
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Glycine; Soja
Family GRAS
Protein Properties Length: 735aa    MW: 82977.8 Da    PI: 6.4227
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Glyma.07G133100.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS360.72.1e-1103627321374
                 GRAS   1 lvelLlecAeavssgdlelaqalLarlselaspdgdpmqRlaayfteALaarlarsvselykalppsetseknsseelaalklfsevsPi 90 
                          l++lL+ cA+av+++d + a++lL+r++++++p gd +qRla+ f+ +L+arla+++s++yk l +++ts    ++ l+a++l+  ++P+
  Glyma.07G133100.1.p 362 LRTLLVLCAQAVAADDYKSAHELLKRIRQHSNPFGDGNQRLAHIFADGLEARLAGTGSQIYKGLVSKRTS---AADFLKAYHLYLAACPF 448
                          5789************************************************************999999...9**************** PP

                 GRAS  91 lkfshltaNqaIleavegeervHiiDfdisqGlQWpaLlqaLasRpegppslRiTgvgspesg..skeeleetgerLakfAeelgvpfef 178
                           k++ ++ N +I ++ +++ r+HiiDf+i +G+QWp+L+q L+  ++g+p+lRiTg++ p++g   +e++ etg rLa +Ae+++v+fe+
  Glyma.07G133100.1.p 449 RKMTAFISNVTIRKSSANSPRLHIIDFGILYGFQWPTLIQRLSL-AGGAPKLRITGIDFPQPGfrPAERIVETGCRLAAYAESFKVEFEY 537
                          ******************************************99.79***************9*************************** PP

                 GRAS 179 nvlvakrledleleeLrvkpgEalaVnlvlqlhrlldesvsleserdevLklvkslsPkvvvvveqeadhnsesFlerflealeyysalf 268
                          n+ +ak++e+++leeL+++++E l+V + ++ +++ldesv ++s+r+++L+l+++++P+++++   +   n++ F++rf eal +ys+lf
  Glyma.07G133100.1.p 538 NA-IAKKWETIQLEELKIDRDEYLVVTCFYRCKNVLDESVVVDSPRNKFLSLIRKVNPNIFIHGITNGAFNAPFFVTRFREALFHYSSLF 626
                          **.7************************************************************************************** PP

                 GRAS 269 dsleaklpreseerikvErellgreivnvvacegaerrerhetlekWrerleeaGFkpvplsekaakqaklllrkvksdgyrveeesgsl 358
                          d+le+ +pre+ er+ +E+e++gre+ nv+aceg er+er et+++W++r+ +aGF + p++ +++k a   + + + + + ++e+s++l
  Glyma.07G133100.1.p 627 DMLETIVPREEWERMLIEKEIFGREALNVIACEGCERVERPETYRQWQARILRAGFLQQPFEREIVKRAIEKVTTSYHKDFVIDEDSQWL 716
                          *********************************************************************99999999888********** PP

                 GRAS 359 vlgWkdrpLvsvSaWr 374
                          ++gWk+r ++++S+W+
  Glyma.07G133100.1.p 717 LQGWKGRIIYALSCWK 732
                          ***************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5098562.654336712IPR005202Transcription factor GRAS
PfamPF035147.3E-108362732IPR005202Transcription factor GRAS
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 735 aa     Download sequence    Send to blast
MQRLMIMDPR LCGPPNEIQL GNQRFENGFF DQSREFGYLQ SNLVPTDTPS SSSVWTHEEP  60
SPEDCEFSDG ILSYISQILM EEDMEDKTCM RQDSLDLQIA ERSFYEVIGE KYPSTPLGHP  120
SSVDPDDGSG EHNLSENYGT CSYNDGDLSS IFTNNFLRRN LGELPNQNFR GNSISQSSYS  180
SSNSVKSSVE GPVDSPSSIL QVPDLNSETQ SILLFQKGVE EASKFLPSGN GLFANLDVAN  240
FSKLKPRVGS DELPVKVEKD EGESFPAGSK IRKHHHMEEE DVEENRSSKQ AAIFSEPTLR  300
SSMIDIILLH SLGDGKKHFM ARREALQTKN DQIVVSNGKS KASNGGKGRS KKQNGKKEVV  360
DLRTLLVLCA QAVAADDYKS AHELLKRIRQ HSNPFGDGNQ RLAHIFADGL EARLAGTGSQ  420
IYKGLVSKRT SAADFLKAYH LYLAACPFRK MTAFISNVTI RKSSANSPRL HIIDFGILYG  480
FQWPTLIQRL SLAGGAPKLR ITGIDFPQPG FRPAERIVET GCRLAAYAES FKVEFEYNAI  540
AKKWETIQLE ELKIDRDEYL VVTCFYRCKN VLDESVVVDS PRNKFLSLIR KVNPNIFIHG  600
ITNGAFNAPF FVTRFREALF HYSSLFDMLE TIVPREEWER MLIEKEIFGR EALNVIACEG  660
CERVERPETY RQWQARILRA GFLQQPFERE IVKRAIEKVT TSYHKDFVID EDSQWLLQGW  720
KGRIIYALSC WKPA*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5hyz_A9e-393667328375GRAS family transcription factor containing p
Search in ModeBase
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Gma.391190.0somatic embryo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAP0150370.0AP015037.1 Vigna angularis var. angularis DNA, chromosome 4, almost complete sequence, cultivar: Shumari.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_003530209.20.0PREDICTED: scarecrow-like protein 9
RefseqXP_006583594.10.0PREDICTED: scarecrow-like protein 9
SwissprotO809330.0SCL9_ARATH; Scarecrow-like protein 9
TrEMBLK7L1H10.0K7L1H1_SOYBN; Uncharacterized protein
STRINGGLYMA07G15950.20.0(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF13134339
Representative plantOGRP26615129
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G37650.10.0GRAS family protein