PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Glyma.07G109600.1.p
Common NameGLYMA_07G109600, LOC100778566
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Glycine; Soja
Family SBP
Protein Properties Length: 339aa    MW: 37267.1 Da    PI: 8.8129
Description SBP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Glyma.07G109600.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SBP132.81.1e-41198275178
                          --SSTT-----TT--HHHHHTT--HHHHT-S-EEETTEEEEE-TTTSSEEETTT--SS--S-STTTT-------S--- CS
                  SBP   1 lCqvegCeadlseakeyhrrhkvCevhskapvvlvsgleqrfCqqCsrfhelsefDeekrsCrrrLakhnerrrkkqa 78 
                          +Cq+egC+adls+ak+yhrrhkvCe+hska++v+++gl+qrfCqqCsrfh lsefD++krsCr+rLa+hn+rrrk+q+
  Glyma.07G109600.1.p 198 RCQAEGCNADLSQAKHYHRRHKVCEFHSKAATVIAAGLTQRFCQQCSRFHLLSEFDNGKRSCRKRLADHNRRRRKTQQ 275
                          6**************************************************************************986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:4.10.1100.103.0E-35193260IPR004333Transcription factor, SBP-box
PROSITE profilePS5114132.376196273IPR004333Transcription factor, SBP-box
SuperFamilySSF1036121.16E-38197277IPR004333Transcription factor, SBP-box
PfamPF031103.2E-31199272IPR004333Transcription factor, SBP-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 339 aa     Download sequence    Send to blast
MLDYEWGNPS TIMLTGNEDS SAAGSDQTHR QIFDHYASHT LIPDHFLHAP MHSTATTAAA  60
TTVDFTHHHF NPQPHHHNHM NHHHHHHAFF DPRAFHGASN TSYPPPPSML SLDPLPHVNA  120
VGSGPGHGPG PGPGPGGLLL VPKSEEVGRP MDFVGSRIGL NLGGRTYFSS SEDDFVSRLY  180
RRSRPVEPGS TISSNSPRCQ AEGCNADLSQ AKHYHRRHKV CEFHSKAATV IAAGLTQRFC  240
QQCSRFHLLS EFDNGKRSCR KRLADHNRRR RKTQQPTQEI QKSQPSLDNV ARSPPDSGAQ  300
SSSSVTVAVS PPDYFRQRPY QSTNNPSSIS SSLFFSSG*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ul4_A1e-31189272184squamosa promoter binding protein-like 4
Search in ModeBase
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Gma.107870.0flower| hypocotyl| root
Cis-element ? help Back to Top
SourceLink
PlantRegMapGlyma.07G109600.1.p
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_003530168.10.0squamosa promoter-binding-like protein 8
TrEMBLI1KJN90.0I1KJN9_SOYBN; Uncharacterized protein
STRINGGLYMA07G14610.10.0(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF68013348
Representative plantOGRP9717230
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G02065.13e-74squamosa promoter binding protein-like 8