PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Glyma.07G109500.1.p
Common NameGLYMA_07G109500, LOC100780159
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Glycine; Soja
Family SBP
Protein Properties Length: 343aa    MW: 38253 Da    PI: 7.683
Description SBP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Glyma.07G109500.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SBP126.31.2e-39154230177
                          --SSTT-----TT--HHHHHTT--HHHHT-S-EEETTEEEEE-TTTSSEEETTT--SS--S-STTTT-------S-- CS
                  SBP   1 lCqvegCeadlseakeyhrrhkvCevhskapvvlvsgleqrfCqqCsrfhelsefDeekrsCrrrLakhnerrrkkq 77 
                          +CqvegC++ l +akeyhrrh+vC++hskap+++v gleqrfCqqCsrfh +sefD++krsCrrrLa+hnerrrk++
  Glyma.07G109500.1.p 154 RCQVEGCHVALVNAKEYHRRHRVCDMHSKAPKAVVLGLEQRFCQQCSRFHVVSEFDDSKRSCRRRLAGHNERRRKSS 230
                          6**************************************************************************86 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:4.10.1100.103.1E-33151216IPR004333Transcription factor, SBP-box
PROSITE profilePS5114132.017152229IPR004333Transcription factor, SBP-box
SuperFamilySSF1036122.49E-37153231IPR004333Transcription factor, SBP-box
PfamPF031101.5E-30155228IPR004333Transcription factor, SBP-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 343 aa     Download sequence    Send to blast
MDFGENNMFS LNTHTKEENE NTPNNNNNIV NVWYSSWDAT TTNSNTLHTS TTAAEGYAGG  60
SHSHHHQQLY GGEGCHVQAD PHLTCLHLGK RHYFEDVTTN GDVNNATPLG NRHVCSGGGA  120
GYVFAGNDKR GRGYYRGGGA AGGGKTAPFA MVPRCQVEGC HVALVNAKEY HRRHRVCDMH  180
SKAPKAVVLG LEQRFCQQCS RFHVVSEFDD SKRSCRRRLA GHNERRRKSS HLSVTRNSRQ  240
GCALSLLSSG SGSRDHHNWL SHHADFSTRC SAALRELIAE NRAALMTRQQ QQLVYDRVWP  300
HLVVAPHHDA DAAVEEEDFE DLQQQQQPES NYFPQHMFPQ TQ*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ul4_A6e-281552281184squamosa promoter binding protein-like 4
Search in ModeBase
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1135144RGGGAAGGGK
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Gma.267550.0leaf| stem
Cis-element ? help Back to Top
SourceLink
PlantRegMapGlyma.07G109500.1.p
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAP0150425e-48AP015042.1 Vigna angularis var. angularis DNA, chromosome 9, almost complete sequence, cultivar: Shumari.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_003530170.10.0squamosa promoter-binding-like protein 7
TrEMBLK7L1B40.0K7L1B4_SOYBN; Uncharacterized protein
STRINGGLYMA07G14641.10.0(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF96132738
Representative plantOGRP9717230
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G42200.12e-35squamosa promoter binding protein-like 9