PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Glyma.07G108900.1.p
Common NameGLYMA_07G108900, LOC100782863
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Glycine; Soja
Family GATA
Protein Properties Length: 238aa    MW: 26549.2 Da    PI: 7.2421
Description GATA family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Glyma.07G108900.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GATA58.11.2e-18143177135
                 GATA   1 CsnCgttkTplWRrgpdgnktLCnaCGlyyrkkgl 35 
                          Cs+C + kTp+WR gp g+ktLCnaCG+++++ +l
  Glyma.07G108900.1.p 143 CSHCASEKTPQWRAGPLGPKTLCNACGVRFKSGRL 177
                          *******************************9885 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM004015.3E-17137187IPR000679Zinc finger, GATA-type
Gene3DG3DSA:3.30.50.107.3E-14141175IPR013088Zinc finger, NHR/GATA-type
SuperFamilySSF577163.94E-14141201No hitNo description
PROSITE profilePS5011411.082141173IPR000679Zinc finger, GATA-type
CDDcd002021.29E-13142189No hitNo description
PfamPF003201.8E-16143177IPR000679Zinc finger, GATA-type
PROSITE patternPS003440143168IPR000679Zinc finger, GATA-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0030154Biological Processcell differentiation
GO:0045944Biological Processpositive regulation of transcription from RNA polymerase II promoter
GO:0005634Cellular Componentnucleus
GO:0005667Cellular Componenttranscription factor complex
GO:0000977Molecular FunctionRNA polymerase II regulatory region sequence-specific DNA binding
GO:0001085Molecular FunctionRNA polymerase II transcription factor binding
GO:0001228Molecular Functiontranscriptional activator activity, RNA polymerase II transcription regulatory region sequence-specific binding
GO:0003682Molecular Functionchromatin binding
GO:0008270Molecular Functionzinc ion binding
Sequence ? help Back to Top
Protein Sequence    Length: 238 aa     Download sequence    Send to blast
MDLYGSFSTP SDCLHIDDFL DFSNITTDTH HHLPPPQNSP LISHDDANLF FNFPSVPTDE  60
AAELEWLSQF VDDDATSFHS FPATASIGSH STSFLSNNNN RNDNNEYPKS SLSSNIPCSS  120
AVAGKSRARR EGSVTGDGGV RRCSHCASEK TPQWRAGPLG PKTLCNACGV RFKSGRLVPE  180
YRPAASPTFV LTQHSNSHRK VMELRRQKEL LRHQQQQQLQ QEQCHRHTHN HHDFKVC*
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Gma.290150.0flower| pod
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_003530174.31e-178PREDICTED: GATA transcription factor 2-like
RefseqXP_006583550.21e-178PREDICTED: GATA transcription factor 2-like
SwissprotO497412e-62GATA2_ARATH; GATA transcription factor 2
TrEMBLI1KJP61e-178I1KJP6_SOYBN; Uncharacterized protein
STRINGGLYMA07G14750.11e-178(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF135501925
Representative plantOGRP6817287
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G45050.12e-52GATA transcription factor 2