PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Glyma.07G100700.1.p
Common NameGLYMA_07G100700, LOC100818474
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Glycine; Soja
Family MYB
Protein Properties Length: 969aa    MW: 108487 Da    PI: 5.1947
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Glyma.07G100700.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding27.29e-09433477246
                          SSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
      Myb_DNA-binding   2 grWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 
                          g+WT eEd+ l+  v+  G ++W  Ia  +g+ Rt+ qc  r+q 
  Glyma.07G100700.1.p 433 GAWTNEEDKSLLLIVQDIGIRNWFDIATSLGTSRTPFQCLARFQR 477
                          79***************************************9995 PP

2Myb_DNA-binding41.23.9e-13487529346
                          SS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
      Myb_DNA-binding   3 rWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 
                           WT+eEd +l  av+ +G ++W ++a+ +  +Rt+ qc +rw k
  Glyma.07G100700.1.p 487 EWTEEEDSQLCSAVASFGARDWQSVASVLE-RRTGTQCSNRWKK 529
                          7*****************************.***********98 PP

3Myb_DNA-binding37.74.7e-12536580147
                          TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
      Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                          +g++T eEd ++  av ++G + W+ Ia++++ gR   qc++r+++ 
  Glyma.07G100700.1.p 536 KGSFTREEDIRITVAVMLFGRK-WNQIANYVP-GRIQSQCRDRYLNC 580
                          799*****************99.*********.***********996 PP

4Myb_DNA-binding48.91.5e-15589630346
                          SS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
      Myb_DNA-binding   3 rWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 
                           WT+eEd++l  av ++G   W++Ia++++  Rt+ qc+ rw  
  Glyma.07G100700.1.p 589 GWTEEEDLRLEAAVVKHGYC-WSKIAEEVP-PRTDSQCRKRWKV 630
                          5*****************99.*********.9**********86 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS500905.959328424IPR017877Myb-like domain
SMARTSM007175.2E-4332428IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.606.7E-12335351IPR009057Homeodomain-like
CDDcd001670.00353389424No hitNo description
Gene3DG3DSA:1.10.10.606.7E-12399438IPR009057Homeodomain-like
SuperFamilySSF466893.16E-16408476IPR009057Homeodomain-like
PROSITE profilePS500909.489427479IPR017877Myb-like domain
SMARTSM007171.0E-7431481IPR001005SANT/Myb domain
CDDcd001679.11E-6434479No hitNo description
PfamPF139212.1E-14435496No hitNo description
Gene3DG3DSA:1.10.10.605.3E-13439490IPR009057Homeodomain-like
PROSITE profilePS5129418.315480535IPR017930Myb domain
SuperFamilySSF466891.06E-21483577IPR009057Homeodomain-like
SMARTSM007178.6E-10484533IPR001005SANT/Myb domain
CDDcd001673.71E-11487531No hitNo description
Gene3DG3DSA:1.10.10.603.0E-17491542IPR009057Homeodomain-like
SMARTSM007173.6E-11535583IPR001005SANT/Myb domain
PROSITE profilePS512949.249536581IPR017930Myb domain
PfamPF002493.6E-11536580IPR001005SANT/Myb domain
CDDcd001671.13E-6538579No hitNo description
Gene3DG3DSA:1.10.10.601.9E-17543588IPR009057Homeodomain-like
SuperFamilySSF466891.93E-23561633IPR009057Homeodomain-like
PROSITE profilePS5129422.53582636IPR017930Myb domain
SMARTSM007172.6E-13586634IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.602.4E-17589631IPR009057Homeodomain-like
PfamPF002494.5E-14589630IPR001005SANT/Myb domain
CDDcd001674.36E-13590631No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 969 aa     Download sequence    Send to blast
MTPRADDFEK DNLSATDDDD DDDDGLKEDM DALARACMIA VPRPDDNSTA EDDIPAEDPL  60
LLAGDSIVPA ATDDDDDQDD LECLKRVQSL YQPLSILPPL TPPAAGSDDD DVDDLETVRA  120
IMKRFSTYDE GSHEGGMEML VEGDQTSSPG YEGDIANDSI YYESDVGELC PVSQHTNEAA  180
TKELIQNVEM KLSDFVESSE PDACGSSKLP QKRLSCPPVV RFFIDAINKN RDLQRFIRSK  240
LIEFEAKIEE NKKMRNKIKI LKDFQASCTR RTGNVLSLKK DPRVQLISSK KSFAPKNSKK  300
PKKASAMCYG PEENSHVANY RMVLERFPLS LDRKKWSNVE RESLLKGIKQ QFQEMVLQLS  360
LSVDSSEGLP GDANGMDDVI ASVKDLAITP ERIRQFLPKV NWNLIASMYV GGRTGAECES  420
RWLNCEDPLI NQGAWTNEED KSLLLIVQDI GIRNWFDIAT SLGTSRTPFQ CLARFQRSLN  480
PSMLNSEWTE EEDSQLCSAV ASFGARDWQS VASVLERRTG TQCSNRWKKS LCPEKKGSFT  540
REEDIRITVA VMLFGRKWNQ IANYVPGRIQ SQCRDRYLNC LDPSLKWGGW TEEEDLRLEA  600
AVVKHGYCWS KIAEEVPPRT DSQCRKRWKV LCPEYVPLLQ EARKKQRSII GCNFVDRESE  660
RPAITLNDFL PLPVPAPKSD VGASNLRKKA KSSNVPKKMS KKLAKRARLH TKEVQDTEVY  720
SDDGIKTYGE VSACSNVPKK MRSKRHTKKT RNCPKEVVDI YCSEKVKTCI ESSESQSTCI  780
ASSGNQDSDN ITIACFLRDK SKEMLSRFTK DLSQASFSSR SIDVSNKQVE SQDPFDDQIG  840
LSKSFDTVGT ENLFVQQNVA SDRRVGKPED ANTLTGGDHE EMTLACFLGN KSKKGSQAAN  900
GRGACSSTII IPDDSGLSMS KHVEKETVLH GGVAEPMDIV VEEKDDELLT SFLQNRPTRQ  960
RKRPSRFL*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1h89_C2e-294016287155MYB PROTO-ONCOGENE PROTEIN
1h88_C2e-294016287155MYB PROTO-ONCOGENE PROTEIN
Search in ModeBase
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1685691LRKKAKS
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Gma.189550.0hypocotyl| leaf
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAP0150441e-137AP015044.1 Vigna angularis var. angularis DNA, chromosome 11, almost complete sequence, cultivar: Shumari.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006583452.10.0PREDICTED: uncharacterized protein LOC100818474 isoform X2
TrEMBLK7L0S70.0K7L0S7_SOYBN; Uncharacterized protein
STRINGGLYMA07G11330.30.0(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF74413344
Representative plantOGRP73551617
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G18100.11e-166myb domain protein 4r1