PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Glyma.07G076800.1.p
Common NameGLYMA_07G076800, LOC100811873
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Glycine; Soja
Family HD-ZIP
Protein Properties Length: 830aa    MW: 90529.4 Da    PI: 6.3365
Description HD-ZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Glyma.07G076800.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox65.48e-21130185156
                          TT--SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHH CS
             Homeobox   1 rrkRttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakek 56 
                          +++ +++t++q++eLe+lF+++++p++++r eL+++l L++rqVk+WFqNrR+++k
  Glyma.07G076800.1.p 130 KKRYHRHTPQQIQELEALFKECPHPDEKQRLELSRRLCLETRQVKFWFQNRRTQMK 185
                          688999***********************************************999 PP

2START209.61.2e-653365601206
                          HHHHHHHHHHHHHHHHC-TT-EEEE....EXCCTTEEEEEEESSS......SCEEEEEEEECCSCHHHHHHHHHCCCGGCT-TT-S.... CS
                START   1 elaeeaaqelvkkalaeepgWvkss....esengdevlqkfeeskv.....dsgealrasgvvdmvlallveellddkeqWdetla.... 77 
                          ela++a++elvk a+ +ep+W++ +    e++n++e++++f++  +     + +ea+r+ g+v+ ++  lve+l+d++ +W e+++    
  Glyma.07G076800.1.p 336 ELALAAMDELVKIAQTGEPLWMRNVeggrEILNNEEYVRTFTPCIGlrpngFVSEASRENGMVIINSLALVETLMDSN-RWAEMFPciia 424
                          5899**************************************9999********************************.*********** PP

                          EEEEEEEECTT......EEEEEEEEXXTTXX-SSX.EEEEEEEEEEE.TTS-EEEEEEEEE-TTS--.-TTSEE-EESSEEEEEEEECTC CS
                START  78 kaetlevissg......galqlmvaelqalsplvp.RdfvfvRyirqlgagdwvivdvSvdseqkppesssvvRaellpSgiliepksng 160
                          + +t+evissg      galqlm aelq+lsplvp R++ f+R+++q+ +g+w++vdvS+ds ++ +  + +v +++lpSg+++++++ng
  Glyma.07G076800.1.p 425 RTSTTEVISSGingtrnGALQLMHAELQVLSPLVPvREVNFLRFCKQHAEGVWAVVDVSIDSIRESSGAPTFVNCRRLPSGCVVQDMPNG 514
                          *****************************************************************999********************** PP

                          EEEEEEEE-EE--SSXXHHHHHHHHHHHHHHHHHHHHHHTXXXXXX CS
                START 161 hskvtwvehvdlkgrlphwllrslvksglaegaktwvatlqrqcek 206
                          +skvtwveh++++++++h+l+r+l++sg+ +ga++wvatlqrqce+
  Glyma.07G076800.1.p 515 YSKVTWVEHAEYDESQVHQLYRPLLSSGMGFGAQRWVATLQRQCEC 560
                          ********************************************96 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466891.11E-20113187IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.601.3E-21117187IPR009057Homeodomain-like
PROSITE profilePS5007117.216127187IPR001356Homeobox domain
SMARTSM003891.7E-17128191IPR001356Homeobox domain
CDDcd000862.06E-18129187No hitNo description
PfamPF000462.2E-18130185IPR001356Homeobox domain
PROSITE patternPS000270162185IPR017970Homeobox, conserved site
PROSITE profilePS5084844.598327563IPR002913START domain
SuperFamilySSF559611.17E-32329560No hitNo description
CDDcd088756.52E-126331559No hitNo description
SMARTSM002341.2E-49336560IPR002913START domain
PfamPF018521.9E-57336560IPR002913START domain
SuperFamilySSF559615.13E-23586822No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0008289Molecular Functionlipid binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 830 aa     Download sequence    Send to blast
MSFGGLLDNK SGSGGARNNV SDIPYNNNNV TNTTTTNNDR MPFGAISQPR LVTTTPTLAK  60
SMFNSSGLSL ALQQTNIDGQ EDVNRMAENT SEPNGLRRSR EDEHESRSGS DNMDGASGDE  120
HDAADNPPRK KRYHRHTPQQ IQELEALFKE CPHPDEKQRL ELSRRLCLET RQVKFWFQNR  180
RTQMKTQLER HENTLLRQEN DKLRAENMSI RDAMRNPMCS NCGGPAIIGE ISLEEQHLRI  240
ENARLKDELD RVCVLAGKFL GRPVSSLPSS SLELGMRGNG FAGIPAATTL PLGQDFDMGM  300
SVSMNNNALA MVSPPTSARA AAAGFDRSVE RSMFLELALA AMDELVKIAQ TGEPLWMRNV  360
EGGREILNNE EYVRTFTPCI GLRPNGFVSE ASRENGMVII NSLALVETLM DSNRWAEMFP  420
CIIARTSTTE VISSGINGTR NGALQLMHAE LQVLSPLVPV REVNFLRFCK QHAEGVWAVV  480
DVSIDSIRES SGAPTFVNCR RLPSGCVVQD MPNGYSKVTW VEHAEYDESQ VHQLYRPLLS  540
SGMGFGAQRW VATLQRQCEC LAILMSSAAP SRDHSAITAG GRRSMMKLAQ RMTNNFCAGV  600
CASTVHKWNK LNAGNVDEDV RVMTRKSVDD PGEPPGIVLS AATSVWLPVS PHRLFDFLRD  660
ERLRSEWDIL SNGGPMQEMA HIAKGQDHGN AVSLLRASAI NSNQSSMLIL QETCIDAAGS  720
LVVYAPVDIP AMHVVMNGGD SAYVALLPSG FAIVPDGPGS RGPPNGPTST TNGGDNGVTR  780
VSGSLLTVAF QILVNSLPTA KLTVESVETV NNLISCTVQK IKAALHCES*
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Gma.92750.0pod| root
Expression -- Description ? help Back to Top
Source Description
UniprotTISSUE SPECIFICITY: Expressed in roots, stems, leaves and floral buds. {ECO:0000269|PubMed:10402424}.
Functional Description ? help Back to Top
Source Description
UniProtProbable transcription factor involved in the regulation of the tissue-specific accumulation of anthocyanins and in cellular organization of the primary root. {ECO:0000269|PubMed:10402424}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapGlyma.07G076800.1.p
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_003528880.10.0homeobox-leucine zipper protein ANTHOCYANINLESS 2 isoform X1
SwissprotQ0WV120.0ANL2_ARATH; Homeobox-leucine zipper protein ANTHOCYANINLESS 2
TrEMBLK7L0990.0K7L099_SOYBN; Uncharacterized protein
STRINGGLYMA07G08340.20.0(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF119234106
Representative plantOGRP14515136
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G00730.10.0HD-ZIP family protein
Publications ? help Back to Top
  1. Duarte JM, et al.
    Expression pattern shifts following duplication indicative of subfunctionalization and neofunctionalization in regulatory genes of Arabidopsis.
    Mol. Biol. Evol., 2006. 23(2): p. 469-78
    [PMID:16280546]