PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Glyma.07G048500.1.p
Common NameGLYMA_07G048500, LOC100101859
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Glycine; Soja
Family MYB_related
Protein Properties Length: 751aa    MW: 82316.4 Da    PI: 6.5537
Description MYB_related family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Glyma.07G048500.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding51.62.2e-162468147
                         TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
      Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47
                         r rWT+eE+ ++++a k++G   W +I +++g ++t+ q++s+ qk+
  Glyma.07G048500.1.p 24 RERWTEEEHNRFLEALKLHGRA-WQRIEEHIG-TKTAVQIRSHAQKF 68
                         78******************88.*********.************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466891.12E-161874IPR009057Homeodomain-like
PROSITE profilePS5129420.2261973IPR017930Myb domain
TIGRFAMsTIGR015579.7E-162271IPR006447Myb domain, plants
SMARTSM007171.3E-122371IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.603.2E-82364IPR009057Homeodomain-like
PfamPF002491.8E-132467IPR001005SANT/Myb domain
CDDcd001671.46E-92669No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 751 aa     Download sequence    Send to blast
MDAYSSGEEV VVKTRKPYTI TKQRERWTEE EHNRFLEALK LHGRAWQRIE EHIGTKTAVQ  60
IRSHAQKFFT KLEKEALVKG VPIGKALDID IPPPRPKRKP NNPYPRKTRI GSASLHSGAK  120
DGKLNLVESS HVNQALNLEK EPLPEKHDLD EGITTVKENK DENRGAVFTL LQEVPCSSVS  180
SANKSSITMS VPLGNPCAFK EITPSVKEVI PRDEKTESFV TIELENGTLE INDRKQTNGT  240
SKDSTLENSD ALHMKLVQNE KTDGLDCALT IDGMQGNQNY PRHVTVHVVD GNLGTNTQNP  300
SQDMLFRDSM FQPIGGVNGQ QNVFTNSAPS NTSESQNNTV RSSVHQSFLP YPPFTQHNQD  360
DCQSFFHMSS TFSNLIISTL MQNPAAHAAA SFAATFWPYA NPETSANSPR CSQGGFTNRQ  420
IGSPPSVAAI AAATVAAATA WWAAHGLLPL CAPLHTSFAC SPASVTAVPS MNTGEAPALK  480
AEQEKTTLQN PPLQDQMLDP EYSEAQQAQH SASKSPAAIL SDSESGDAKL NTSSKATDHE  540
TNKTIPEHLD SNKTKGRKPV DRSSCGSHTA SSSDVETDAL EKGEKGKEEP ETPDANQLAI  600
DFSNRRRSVS NLTDSWKEVS EEGRLAFQAL FSREVLPQSF SPPHALKNKN QQMDNANNNK  660
QNIDDKDEDP DSKKCSSNYE AMQKNLPFVE NNEGLLTIGL GQGKLKTRRT GFKPYKRCSM  720
EAKENRVGAS NNQGEEQGCK RIRLEGETST *
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Gma.176970.0cotyledon| epicotyl| flower| hypocotyl| leaf| pod| root| stem
Cis-element ? help Back to Top
SourceLink
PlantRegMapGlyma.07G048500.1.p
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankEU0764330.0EU076433.1 Glycine max late elongated hypocotyl and circadian clock associated-1-like protein 1 (LCL1) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqNP_001345919.10.0LHY1/CCA1-like protein
RefseqXP_006583199.10.0LHY1/CCA1-like protein isoform X1
RefseqXP_006583200.10.0LHY1/CCA1-like protein isoform X1
RefseqXP_006583201.10.0LHY1/CCA1-like protein isoform X1
RefseqXP_006583202.10.0LHY1/CCA1-like protein isoform X1
RefseqXP_014633207.10.0LHY1/CCA1-like protein isoform X1
TrEMBLK7KZP50.0K7KZP5_SOYBN; Uncharacterized protein
STRINGGLYMA07G05410.60.0(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF48602537
Representative plantOGRP9903510
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G01060.31e-134MYB_related family protein