PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Glyma.07G039400.1.p
Common NameGLYMA_07G039400, LOC100806550
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Glycine; Soja
Family GRAS
Protein Properties Length: 543aa    MW: 59982.7 Da    PI: 5.7828
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Glyma.07G039400.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS248.23.2e-761585332374
                 GRAS   2 velLlecAeavssgdlelaqalLarlselaspdgdpmqRlaayfteALaarlarsvselykalppsetseknsseelaalklfsevsPil 91 
                          ++lL  cA a++ g+l+++q+lL  l+elasp+gd+++Rlaa+ ++AL ++l++s +++++   + +++  +     + l  f+evsP++
  Glyma.07G039400.1.p 158 EQLLNPCAAAITGGNLNRVQHLLYVLHELASPTGDANHRLAAHGLKALTQHLSSSPTSTSSGSITFASA--EPRFFQKTLLKFYEVSPWF 245
                          689***************************************************555555444333333..23333333344******** PP

                 GRAS  92 kfshltaNqaIleavege....ervHiiDfdisqGlQWpaLlqaLasRp.egppslRiTgvgspesg.......skeeleetgerLakfA 169
                           f + +aN  Il+ + ++    +++Hi+D+++s+G+QWp++l+aL+ R+ ++pp +R+T+v +++s+             +  +rL  fA
  Glyma.07G039400.1.p 246 SFPNNIANASILQVLGEDtdnsRTLHILDIGVSHGMQWPTFLEALSRRAgGPPPLVRLTVVTASSSTendtpfcIGPPGDNFSSRLLGFA 335
                          ************9876655555999************************55666*******99888888888877788999********* PP

                 GRAS 170 eelgvpfefnvlvakrledleleeLrvkpgEalaVnlvlqlhrlldesvsleserdevLklvkslsPkvvvvveqeadh...nsesFler 256
                          ++++v++++n l    l++l+ ++ + +p+E  +V+ +++lh+l    ++ ++er+++L ++++++Pk v+++++++ +     ++F+++
  Glyma.07G039400.1.p 336 QSMNVNLQINKLDNCPLHSLNAQSVDASPDEIFVVCAQFRLHQLN---HNAPDERSKFLTVLRNMEPKGVILSDNNLGCccnCCGDFATG 422
                          ***********9777*****************************8...66666678********************6653323579**** PP

                 GRAS 257 flealeyysalfdsleaklpreseerikvErellgreivnvvacegaerrerhetlekWrerleeaGFkpvplsekaakqaklllrkvk. 345
                          f++ +ey + ++ds+++ +    + r + Er++++ e+ ++++++ +     +e +ekW er++eaGF +  ++e+a +  ++llrk++ 
  Glyma.07G039400.1.p 423 FSRRVEYLWRFLDSTSSAF----KGRESEERRVMEGEAAKALTNQRET----NEGKEKWCERMKEAGFVEEVFGEDAIDGGRALLRKYEs 504
                          ***************6665....5566666666666688888776665....9************************************9 PP

                 GRAS 346 sdgyrveeesgslvlgWkdrpLvsvSaWr 374
                          +++++ve+++ s+ l Wk++++ ++S W+
  Glyma.07G039400.1.p 505 NWEMKVEDDNRSVGLWWKGQSVSFCSLWK 533
                          999*************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5098538.675131512IPR005202Transcription factor GRAS
PfamPF035141.1E-73158533IPR005202Transcription factor GRAS
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:2000032Biological Processregulation of secondary shoot formation
GO:0005634Cellular Componentnucleus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 543 aa     Download sequence    Send to blast
MIMEPNPTPD HSLDWFEGSV SYFPPFLDYP YNSSDIQEYQ LWEQDIASNY QTDTNTSSPN  60
ATNIVTITTP LETCDSNNLP LSDLPKKRSA TDESSPKPPQ NHKHKKIKSK PRNNEADNGD  120
AEATTTTTAT VRKSGGNKKG GAKANGNNCN NKDGRWAEQL LNPCAAAITG GNLNRVQHLL  180
YVLHELASPT GDANHRLAAH GLKALTQHLS SSPTSTSSGS ITFASAEPRF FQKTLLKFYE  240
VSPWFSFPNN IANASILQVL GEDTDNSRTL HILDIGVSHG MQWPTFLEAL SRRAGGPPPL  300
VRLTVVTASS STENDTPFCI GPPGDNFSSR LLGFAQSMNV NLQINKLDNC PLHSLNAQSV  360
DASPDEIFVV CAQFRLHQLN HNAPDERSKF LTVLRNMEPK GVILSDNNLG CCCNCCGDFA  420
TGFSRRVEYL WRFLDSTSSA FKGRESEERR VMEGEAAKAL TNQRETNEGK EKWCERMKEA  480
GFVEEVFGED AIDGGRALLR KYESNWEMKV EDDNRSVGLW WKGQSVSFCS LWKLDGNDQS  540
ST*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5hyz_A1e-181585336375GRAS family transcription factor containing p
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_003529836.10.0PREDICTED: nodulation-signaling pathway 1 protein-like
SwissprotQ4VYC80.0NSP1_MEDTR; Nodulation-signaling pathway 1 protein
TrEMBLA0A0B2NWJ40.0A0A0B2NWJ4_GLYSO; Nodulation-signaling pathway 1 protein
TrEMBLI1KHC20.0I1KHC2_SOYBN; Uncharacterized protein
STRINGGLYMA07G04430.10.0(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF68743447
Representative plantOGRP40821525
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G13840.11e-158GRAS family protein