PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Glyma.06G265500.1.p
Common NameGLYMA_06G265500, LOC100775665
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Glycine; Soja
Family GRAS
Protein Properties Length: 569aa    MW: 63053 Da    PI: 5.9667
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Glyma.06G265500.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS426.22.6e-1301985671373
                 GRAS   1 lvelLlecAeavssgdlelaqalLarlselaspdgdpmqRlaayfteALaarlarsvselykalppsetseknsseelaalklfsevsPi 90 
                          l++lL+ cA+a+s+++++  ++l+++ +  +s +g+p+qRl ay++e+L ar   s++++y+al+++e +    ++ l++++l++e++P+
  Glyma.06G265500.1.p 198 LKQLLIVCAKALSENNMKGFDQLIEKARSAVSITGEPIQRLGAYLVEGLVARKEASGNNIYHALRCREPE---GKDLLSYMQLLYEICPY 284
                          679******************************************************************9...9**************** PP

                 GRAS  91 lkfshltaNqaIleavegeervHiiDfdisqGlQWpaLlqaLasRpegppslRiTgvgspesg..skeeleetgerLakfAeelgvpfef 178
                          lkf++++aN aI ea  +e+ +HiiDf+i+qG+QW++LlqaLa+Rp+g+p++RiTg++++ s+  + + le++g+rLa + +++++p+ef
  Glyma.06G265500.1.p 285 LKFGYMAANGAIAEACRNEDLIHIIDFQIGQGTQWMTLLQALAARPGGAPHVRITGIDDQLSKyvRGDGLEAVGKRLAAISQTFNIPVEF 374
                          ***********************************************************877789************************* PP

                 GRAS 179 nvlvakrledleleeLrvkpgEalaVnlvlqlhrlldesvsleserdevLklvkslsPkvvvvveqeadhnsesFlerflealeyysalf 268
                          +  v     d++ ++L+v+pgEalaVn+ lqlh++ desv+++++rd +L+lvkslsPkv ++veqe+++n+++F++rf+e+l+yy a+f
  Glyma.06G265500.1.p 375 HG-VPVLAPDVTKDMLDVRPGEALAVNFPLQLHHTADESVDMSNPRDGLLRLVKSLSPKVTTLVEQESNTNTTPFFNRFIETLDYYLAIF 463
                          **.67788999******************************************************************************* PP

                 GRAS 269 dsleaklpreseerikvErellgreivnvvacegaerrerhetlekWrerleeaGFkpvplsekaakqaklllrkvksdgyrveeesgsl 358
                          +s++++lpr+s+er++vE+++l+r+ivn++aceg+er+erhe l+kW++rl++aGF+++pls+++++ +++llr ++ + y++ e++g++
  Glyma.06G265500.1.p 464 ESIDVSLPRKSKERVNVEQHCLARDIVNIIACEGKERVERHELLGKWKSRLTMAGFRQYPLSSYVNSVIRSLLRCYS-EHYNLVEKDGAM 552
                          *************************************************************************9999.66********** PP

                 GRAS 359 vlgWkdrpLvsvSaW 373
                          +lgWkdr+L+s+SaW
  Glyma.06G265500.1.p 553 LLGWKDRNLISASAW 567
                          *************** PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5098565.579172549IPR005202Transcription factor GRAS
PfamPF035149.0E-128198567IPR005202Transcription factor GRAS
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 569 aa     Download sequence    Send to blast
MDLNQFSSFN VISSAGFPCA SSCTPISPIS NRLLGSLKLD IGNSPNSALS THFDSDTVSS  60
ALSDSQEQHN CGEIHSGVNS CNSLQESNHY LHRPVSSVDH LEDGLHLSTR SFFPQDASYD  120
HETRHALLEL ETSLMAPDDE DQVTTSSTSL GDSSRPTASD QRNRSWSHEG QSSDVAYVEK  180
RHKSMEEALL QGFPSSNLKQ LLIVCAKALS ENNMKGFDQL IEKARSAVSI TGEPIQRLGA  240
YLVEGLVARK EASGNNIYHA LRCREPEGKD LLSYMQLLYE ICPYLKFGYM AANGAIAEAC  300
RNEDLIHIID FQIGQGTQWM TLLQALAARP GGAPHVRITG IDDQLSKYVR GDGLEAVGKR  360
LAAISQTFNI PVEFHGVPVL APDVTKDMLD VRPGEALAVN FPLQLHHTAD ESVDMSNPRD  420
GLLRLVKSLS PKVTTLVEQE SNTNTTPFFN RFIETLDYYL AIFESIDVSL PRKSKERVNV  480
EQHCLARDIV NIIACEGKER VERHELLGKW KSRLTMAGFR QYPLSSYVNS VIRSLLRCYS  540
EHYNLVEKDG AMLLGWKDRN LISASAWH*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5hyz_A2e-611955681375GRAS family transcription factor containing p
Search in ModeBase
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Gma.255720.0root
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAP0150390.0AP015039.1 Vigna angularis var. angularis DNA, chromosome 6, almost complete sequence, cultivar: Shumari.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_003526176.10.0PREDICTED: scarecrow-like protein 21
RefseqXP_006582237.10.0PREDICTED: scarecrow-like protein 21
RefseqXP_006582238.10.0PREDICTED: scarecrow-like protein 21
SwissprotQ69VG10.0CIGR1_ORYSJ; Chitin-inducible gibberellin-responsive protein 1
TrEMBLI1KEE10.0I1KEE1_SOYBN; Uncharacterized protein
STRINGGLYMA06G41500.10.0(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF42993360
Representative plantOGRP8948915
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G48150.21e-179GRAS family protein