PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Glyma.06G238100.1.p
Common NameGLYMA_06G238100, LOC100800646
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Glycine; Soja
Family SBP
Protein Properties Length: 186aa    MW: 20885.1 Da    PI: 8.9191
Description SBP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Glyma.06G238100.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SBP136.86.7e-4365141278
                          -SSTT-----TT--HHHHHTT--HHHHT-S-EEETTEEEEE-TTTSSEEETTT--SS--S-STTTT-------S--- CS
                  SBP   2 CqvegCeadlseakeyhrrhkvCevhskapvvlvsgleqrfCqqCsrfhelsefDeekrsCrrrLakhnerrrkkqa 78 
                          Cq+e+C adl++ak+yhrrhkvCe+hskapvv+v+gl+qrfCqqCsrfh+l efDe+krsCrrrLa+hnerrrk+++
  Glyma.06G238100.1.p  65 CQAERCGADLTDAKRYHRRHKVCEFHSKAPVVVVAGLRQRFCQQCSRFHDLAEFDESKRSCRRRLAGHNERRRKSNP 141
                          **************************************************************************986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:4.10.1100.104.5E-3657126IPR004333Transcription factor, SBP-box
PROSITE profilePS5114132.75362139IPR004333Transcription factor, SBP-box
SuperFamilySSF1036125.62E-4063142IPR004333Transcription factor, SBP-box
PfamPF031105.5E-3265138IPR004333Transcription factor, SBP-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0010321Biological Processregulation of vegetative phase change
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 186 aa     Download sequence    Send to blast
MERERALFER VRKNSTVEEE VENEVEEEDE SGVSITEEEK KKGVGSSGGR RGSSGGSGGV  60
SPPSCQAERC GADLTDAKRY HRRHKVCEFH SKAPVVVVAG LRQRFCQQCS RFHDLAEFDE  120
SKRSCRRRLA GHNERRRKSN PEASNEGSTK GHHPKETTHC RLANERERIQ MNLPGSSGYK  180
SFNIR*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ul4_A4e-3852138184squamosa promoter binding protein-like 4
Search in ModeBase
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Gma.419010.0flower
Functional Description ? help Back to Top
Source Description
UniProtProbable transcriptional factor. Binds to the promoter of the SQUAMOSA gene.
Cis-element ? help Back to Top
SourceLink
PlantRegMapGlyma.06G238100.1.p
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAC2358170.0AC235817.2 Glycine max clone GM_WBa0006O01, complete sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_003526029.11e-132squamosa promoter-binding protein 1
SwissprotQ387416e-43SBP1_ANTMA; Squamosa promoter-binding protein 1
TrEMBLI1KDS81e-130I1KDS8_SOYBN; Uncharacterized protein
STRINGGLYMA06G36140.11e-131(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF53534153
Representative plantOGRP9717230
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G53160.23e-42squamosa promoter binding protein-like 4
Publications ? help Back to Top
  1. Klein J,Saedler H,Huijser P
    A new family of DNA binding proteins includes putative transcriptional regulators of the Antirrhinum majus floral meristem identity gene SQUAMOSA.
    Mol. Gen. Genet., 1996. 250(1): p. 7-16
    [PMID:8569690]