PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Glyma.06G206400.1.p
Common NameGLYMA_06G206400
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Glycine; Soja
Family Dof
Protein Properties Length: 304aa    MW: 33256.3 Da    PI: 7.964
Description Dof family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Glyma.06G206400.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-Dof122.81.2e-383088462
               zf-Dof  4 kalkcprCdstntkfCyynnyslsqPryfCkaCrryWtkGGalrnvPvGggrrknkkss 62
                           lkcprCds ntkfCyynny+lsqPr+fCk+CrryWtkGG lrnvPvGgg+rk+k+s+
  Glyma.06G206400.1.p 30 PPLKCPRCDSLNTKFCYYNNYNLSQPRHFCKNCRRYWTKGGVLRNVPVGGGCRKSKRSN 88
                         6789***************************************************9975 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5088429.733286IPR003851Zinc finger, Dof-type
ProDomPD0074788.0E-253281IPR003851Zinc finger, Dof-type
PfamPF027014.4E-333286IPR003851Zinc finger, Dof-type
PROSITE patternPS0136103470IPR003851Zinc finger, Dof-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 304 aa     Download sequence    Send to blast
MHETHSIGGG RFYGGGDRRL RPHHQQQQPP PLKCPRCDSL NTKFCYYNNY NLSQPRHFCK  60
NCRRYWTKGG VLRNVPVGGG CRKSKRSNKP KTTTTTTTSN TNNNRSSFSA TAPATAPTPP  120
APELEHHSHS HSSSESSTLT VTATEEMSAP PPTTSNAPSK NSLLLDNDHR EAKMFANPNP  180
NPSLDSGGIF SEIGNFTSLI NLNNNEAFGV TNQVQAAAGG GHGQWQQQNH QEFGTASFLD  240
HTVPLEFSSL QHKTGHQGGF GSLDWQPGAD QGLFDLPNTV DQPYWTHAHW SDQDNTSSLF  300
HLP*
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1815GGRFYGGG
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Gma.176841e-168seed coat
Cis-element ? help Back to Top
SourceLink
PlantRegMapGlyma.06G206400.1.p
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankDQ8572732e-96DQ857273.1 Glycine max Dof22 mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_028237396.11e-154dof zinc finger protein DOF5.4-like
TrEMBLK7KW990.0K7KW99_SOYBN; Uncharacterized protein
STRINGGLYMA06G22797.10.0(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF59983050
Representative plantOGRP3817445
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G60850.17e-32OBF binding protein 4