PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Glyma.06G205700.1.p
Common NameGLYMA_06G205700
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Glycine; Soja
Family SBP
Protein Properties Length: 381aa    MW: 41858.7 Da    PI: 7.9591
Description SBP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Glyma.06G205700.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SBP126.79e-4070145277
                          -SSTT-----TT--HHHHHTT--HHHHT-S-EEETTEEEEE-TTTSSEEETTT--SS--S-STTTT-------S-- CS
                  SBP   2 CqvegCeadlseakeyhrrhkvCevhskapvvlvsgleqrfCqqCsrfhelsefDeekrsCrrrLakhnerrrkkq 77 
                          Cqv gC++dls +k+yh+ hkvCevhsk+ +v+v+g+eqrfCqqCsrfh l efD++krsCr+ La+hnerrrk+q
  Glyma.06G205700.1.p  70 CQVYGCNKDLSGCKDYHKGHKVCEVHSKTYKVIVNGIEQRFCQQCSRFHLLAEFDDGKRSCRKCLAGHNERRRKPQ 145
                          **************************************************************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:4.10.1100.102.2E-3263131IPR004333Transcription factor, SBP-box
PROSITE profilePS5114130.85567144IPR004333Transcription factor, SBP-box
SuperFamilySSF1036126.02E-3768148IPR004333Transcription factor, SBP-box
PfamPF031106.4E-2970143IPR004333Transcription factor, SBP-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 381 aa     Download sequence    Send to blast
EDFNSKLSNS LGDSNGGNSL IDLKLGRFDD HGDAMVPTFS KGAPILSLLE SSTPPKRVRA  60
LGAHSQTAYC QVYGCNKDLS GCKDYHKGHK VCEVHSKTYK VIVNGIEQRF CQQCSRFHLL  120
AEFDDGKRSC RKCLAGHNER RRKPQVGIHS GKAGRLLQLY PDLSKPEDNT SFTFRPLSSI  180
PITNGHPQSR SLFPSYSEKQ VPLLHKNGAT SATGNVFSEN NNQYHPPSLG GQSSGSQSLF  240
QDTSLGSEDF NVFNTESAVQ GLSQSSGIPM ARPMVIPSSH SHYSMNQVSE KMMGISSQAS  300
NKVFDRFPPE FNPVDGRHLR PILISDNNEI FNFEMADGIF QGSDFVNVKD HLSCEDGLTF  360
DSFQLSSPLQ RVSNRGSSCR *
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ul4_A2e-26701431184squamosa promoter binding protein-like 4
Search in ModeBase
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Gma.186580.0root| stem
Cis-element ? help Back to Top
SourceLink
PlantRegMapGlyma.06G205700.1.p
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006578521.10.0squamosa promoter-binding-like protein 16
RefseqXP_014630196.10.0squamosa promoter-binding-like protein 16
RefseqXP_014630197.10.0squamosa promoter-binding-like protein 16
RefseqXP_028228978.10.0squamosa promoter-binding-like protein 16
RefseqXP_028228980.10.0squamosa promoter-binding-like protein 16
TrEMBLK7KW870.0K7KW87_SOYBN; Uncharacterized protein
STRINGGLYMA06G22545.10.0(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF18193493
Representative plantOGRP9717230
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G69170.13e-47SBP family protein