PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Glyma.06G194800.1.p
Common NameGLYMA_06G194800, LOC100798021
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Glycine; Soja
Family Dof
Protein Properties Length: 459aa    MW: 50238.6 Da    PI: 6.8293
Description Dof family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Glyma.06G194800.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-Dof125.71.4e-39121181262
               zf-Dof   2 kekalkcprCdstntkfCyynnyslsqPryfCkaCrryWtkGGalrnvPvGggrrknkkss 62 
                          ++k+l+cprC+s++tkfCyynny+++qPryfCkaC+ryWt+GG++rnvPvG+grrknk+s 
  Glyma.06G194800.1.p 121 PDKILPCPRCNSMDTKFCYYNNYNVNQPRYFCKACQRYWTAGGTMRNVPVGAGRRKNKNSA 181
                          7899******************************************************976 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
ProDomPD0074786.0E-28121178IPR003851Zinc finger, Dof-type
PfamPF027012.6E-32123179IPR003851Zinc finger, Dof-type
PROSITE profilePS5088428.686125179IPR003851Zinc finger, Dof-type
PROSITE patternPS013610127163IPR003851Zinc finger, Dof-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 459 aa     Download sequence    Send to blast
MQENKDPAIK LFGQKIAFAG EVDPPAISAG EIDSPPAMDV DKDEEDDFGD SETEDEKDKD  60
PRAEKVSEKT KEADPPPNAA DSKKTPEGIQ NPNTPSIDEE SAKSKTNKSE NNNNNKTLKK  120
PDKILPCPRC NSMDTKFCYY NNYNVNQPRY FCKACQRYWT AGGTMRNVPV GAGRRKNKNS  180
ASHYRHITIS EALQAARIDA APNGTHHLLK PNGRVLSFGL ELDPPICDSM ASVLNLTAEK  240
KGTLNNNSRN NNNNNNNNGD DCSSASSITV SNEENGKSTS QESIVVPNSN GFIHHVPCIS  300
TLPWPYPFPS GAPAMCPPGF PMSFYPAAFW NIPWFPSQHS HHSSAPTPRS PNSPTLGKHS  360
RDDDATKQYH LQEEQPPSRQ RNGSVLVPKT LRIDDPSEAA KSSIWATLGI KNECVTGGGM  420
FKGFQSKKEE KDHVVEASPV LRANPAALSR SLNFHENS*
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Gma.452940.0leaf| pod
Expression -- Description ? help Back to Top
Source Description
UniprotTISSUE SPECIFICITY: Expressed in the vasculature of cotyledons and hypocotyls, leaves and roots. {ECO:0000269|PubMed:19619493}.
Functional Description ? help Back to Top
Source Description
UniProtTranscription factor that binds specifically to a 5'-AA[AG]G-3' consensus core sequence (By similarity). Regulates a photoperiodic flowering response. Transcriptional repressor of 'CONSTANS' expression. {ECO:0000250, ECO:0000269|PubMed:19619493}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapGlyma.06G194800.1.p
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: Circadian-regulation. Highly expressed at the beginning of the light period, then decreases, reaching a minimum between 16 and 29 hours after dawn before rising again at the end of the day. {ECO:0000269|PubMed:19619493}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_003527086.10.0cyclic dof factor 3
RefseqXP_028237260.10.0cyclic dof factor 3-like
SwissprotQ8LFV31e-119CDF3_ARATH; Cyclic dof factor 3
TrEMBLA0A0B2R2M50.0A0A0B2R2M5_GLYSO; Cyclic dof factor 3
TrEMBLI1KCU10.0I1KCU1_SOYBN; Uncharacterized protein
STRINGGLYMA06G20950.10.0(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF62534147
Representative plantOGRP3817445
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G47500.11e-106cycling DOF factor 3
Publications ? help Back to Top
  1. Duarte JM, et al.
    Expression pattern shifts following duplication indicative of subfunctionalization and neofunctionalization in regulatory genes of Arabidopsis.
    Mol. Biol. Evol., 2006. 23(2): p. 469-78
    [PMID:16280546]
  2. Ding Y, et al.
    Four distinct types of dehydration stress memory genes in Arabidopsis thaliana.
    BMC Plant Biol., 2013. 13: p. 229
    [PMID:24377444]
  3. Corrales AR, et al.
    Multifaceted role of cycling DOF factor 3 (CDF3) in the regulation of flowering time and abiotic stress responses in Arabidopsis.
    Plant Cell Environ., 2017. 40(5): p. 748-764
    [PMID:28044345]
  4. Renau-Morata B, et al.
    Ectopic Expression of CDF3 Genes in Tomato Enhances Biomass Production and Yield under Salinity Stress Conditions.
    Front Plant Sci, 2017. 8: p. 660
    [PMID:28515731]
  5. Henriques R, et al.
    The antiphasic regulatory module comprising CDF5 and its antisense RNA FLORE links the circadian clock to photoperiodic flowering.
    New Phytol., 2017. 216(3): p. 854-867
    [PMID:28758689]