PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Glyma.06G194300.1.p
Common NameGLYMA_06G194300
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Glycine; Soja
Family Nin-like
Protein Properties Length: 269aa    MW: 31469.4 Da    PI: 5.9386
Description Nin-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Glyma.06G194300.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1RWP-RK80.91.3e-25135184352
               RWP-RK   3 keisledlskyFslpikdAAkeLgvclTvLKriCRqyGIkRWPhRkiksl 52 
                          k +s  ++s+yF++pi +AA+eL+v+lT LK++CR++GI+RWPhRk+ sl
  Glyma.06G194300.1.p 135 KMLSRTTVSQYFYMPISKAARELNVGLTHLKKRCRELGIQRWPHRKLMSL 184
                          789999*****************************************997 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5151917.416117205IPR003035RWP-RK domain
PfamPF020426.4E-21137184IPR003035RWP-RK domain
Sequence ? help Back to Top
Protein Sequence    Length: 269 aa     Download sequence    Send to blast
MENQQLTFWK SNYDIDDYYP FAPTSQFSSY DYCGWGSAAD GYHWPHEFPL QDSYLDAIPF  60
MKFYYPHDIL YETTLPIEPT SLSIQDYDFS DWNEIDGSDH KPVFSSCNDG ESVSEMKEDL  120
NAKKCREEKI SSSAKMLSRT TVSQYFYMPI SKAARELNVG LTHLKKRCRE LGIQRWPHRK  180
LMSLQTLIKN IQEQGEAEGH ENDEKLRAAI EMLKREKRKV EEMPDLELED NTRRLRQACF  240
KANYKKRKLV GMRFIEPESS LSGLSNKY*
Cis-element ? help Back to Top
SourceLink
PlantRegMapGlyma.06G194300.1.p
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_028236548.10.0protein RKD1-like
TrEMBLK7KVZ10.0K7KVZ1_SOYBN; Uncharacterized protein
STRINGGLYMA06G20881.10.0(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF61843052
Representative plantOGRP5671777
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G18790.12e-56RWP-RK domain-containing protein