PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Glyma.06G168600.3.p
Common NameGLYMA_06G168600, LOC102664649
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Glycine; Soja
Family SBP
Protein Properties Length: 376aa    MW: 40749.3 Da    PI: 8.6271
Description SBP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Glyma.06G168600.3.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SBP130.46.2e-4170146278
                          -SSTT-----TT--HHHHHTT--HHHHT-S-EEETTEEEEE-TTTSSEEETTT--SS--S-STTTT-------S--- CS
                  SBP   2 CqvegCeadlseakeyhrrhkvCevhskapvvlvsgleqrfCqqCsrfhelsefDeekrsCrrrLakhnerrrkkqa 78 
                          C v+gC++dls++++yhrrhkvCe hsk+p+v+++gl+qrfCqqCsrfh+l++fDe+krsCr+rL++hn+rrrk+q+
  Glyma.06G168600.3.p  70 CLVDGCNSDLSNCRDYHRRHKVCELHSKTPEVTIAGLKQRFCQQCSRFHSLEQFDERKRSCRKRLDGHNRRRRKPQP 146
                          **************************************************************************997 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:4.10.1100.103.7E-3265131IPR004333Transcription factor, SBP-box
PROSITE profilePS5114131.65867144IPR004333Transcription factor, SBP-box
SuperFamilySSF1036122.62E-3868149IPR004333Transcription factor, SBP-box
PfamPF031103.3E-3070143IPR004333Transcription factor, SBP-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 376 aa     Download sequence    Send to blast
MKGEFSVDLK LGHHHVGNSG TESALANKSK DAAAASGAAA SAGVSKMASS PSGSSKRART  60
ISSTSLTVSC LVDGCNSDLS NCRDYHRRHK VCELHSKTPE VTIAGLKQRF CQQCSRFHSL  120
EQFDERKRSC RKRLDGHNRR RRKPQPEPLS RPGSFLSNYQ GTQLLPFSGP HVYASTAMVS  180
PDWSGALVTS SADARLHNHN HHHHQQDLFL GSSHKEGKQV AFLHSNHHPS TLSNQNPPPF  240
PSPSICHTLL RTRPLSETCG GGARSKMFCE SLTTTTTASN NNNNSLHDTI PCALSLLSSS  300
QTHTPGGNGL NQMVQQPPPP SMSLMMQPLG LSLQDNNNNS LESVDHCSSI YSLASDHHGS  360
HCNEAAPQLF PFQWE*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ul4_A3e-28701431184squamosa promoter binding protein-like 4
Search in ModeBase
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1125142RKRSCRKRLDGHNRRRRK
2125143RKRSCRKRLDGHNRRRRKP
3126143KRSCRKRLDGHNRRRRKP
Cis-element ? help Back to Top
SourceLink
PlantRegMapGlyma.06G168600.3.p
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAP0150358e-72AP015035.1 Vigna angularis var. angularis DNA, chromosome 2, almost complete sequence, cultivar: Shumari.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006581859.10.0squamosa promoter-binding-like protein 13A isoform X1
RefseqXP_006581860.10.0squamosa promoter-binding-like protein 13A isoform X2
RefseqXP_014631998.10.0squamosa promoter-binding-like protein 13A isoform X1
TrEMBLK7KVJ30.0K7KVJ3_SOYBN; Uncharacterized protein
TrEMBLK7KVJ40.0K7KVJ4_SOYBN; Uncharacterized protein
STRINGGLYMA06G17700.20.0(Glycine max)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G50670.11e-58SBP family protein