PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Glyma.06G154400.1.p
Common NameGLYMA_06G154400, LOC100815777
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Glycine; Soja
Family NAC
Protein Properties Length: 205aa    MW: 23658.4 Da    PI: 4.4144
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Glyma.06G154400.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM108.58e-3481271128
                  NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykv.ePwdLpkkvkaeekewyfFskrdkkyatgkrknratksgyWkatgkd 89 
                          lppGf F+Ptdeelvv++L  k++  + +  ++i+++d  ++ +Pw+L+ k+  + +++yfF+k +        +nr+t++gyWk tg +
  Glyma.06G154400.1.p   8 LPPGFLFSPTDEELVVHFLYCKASLIPYHP-NIIPDLDPSQLdDPWELNGKALLSGNQYYFFTKVN--------ENRTTENGYWKDTGVT 88 
                          79*************************888.89*****999868****966667789999999874........5899************ PP

                  NAM  90 kevlskkgelvglkktLvfykgrapkgektdWvmheyrl 128
                          k++ls+ +++vg+kk Lvf+ g+ap+g++t+Wvm+ey++
  Glyma.06G154400.1.p  89 KPILSTFDKEVGMKKYLVFHIGEAPQGTETSWVMQEYHI 127
                          ******99*****************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019412.22E-405160IPR003441NAC domain
PROSITE profilePS5100538.2858161IPR003441NAC domain
PfamPF023655.8E-229127IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 205 aa     Download sequence    Send to blast
MEDESINLPP GFLFSPTDEE LVVHFLYCKA SLIPYHPNII PDLDPSQLDD PWELNGKALL  60
SGNQYYFFTK VNENRTTENG YWKDTGVTKP ILSTFDKEVG MKKYLVFHIG EAPQGTETSW  120
VMQEYHICSS EFDTASYRSV RRRRKHDQSW SKCVLCRVYE KIRSQQSVDC YRDDDDDGSG  180
SELSWLDEVY LSLDDDLKEI GMPI*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ut4_A1e-32616615170NO APICAL MERISTEM PROTEIN
1ut4_B1e-32616615170NO APICAL MERISTEM PROTEIN
1ut7_A1e-32616615170NO APICAL MERISTEM PROTEIN
1ut7_B1e-32616615170NO APICAL MERISTEM PROTEIN
3swm_A1e-32616618173NAC domain-containing protein 19
3swm_B1e-32616618173NAC domain-containing protein 19
3swm_C1e-32616618173NAC domain-containing protein 19
3swm_D1e-32616618173NAC domain-containing protein 19
3swp_A1e-32616618173NAC domain-containing protein 19
3swp_B1e-32616618173NAC domain-containing protein 19
3swp_C1e-32616618173NAC domain-containing protein 19
3swp_D1e-32616618173NAC domain-containing protein 19
4dul_A1e-32616615170NAC domain-containing protein 19
4dul_B1e-32616615170NAC domain-containing protein 19
Search in ModeBase
Expression -- Description ? help Back to Top
Source Description
UniprotTISSUE SPECIFICITY: Expressed in root xylem vessels (PubMed:15923329). Expressed in stems, vascular tissue of cauline leaves and tracheary elements of sepals (PubMed:18069942). {ECO:0000269|PubMed:15923329, ECO:0000269|PubMed:18069942}.
Functional Description ? help Back to Top
Source Description
UniProtProbable transcription factor that influences tracheary elements and xylem development by negatively regulating secondary cell wall fiber synthesis and programmed cell death. {ECO:0000269|PubMed:18069942, ECO:0000269|PubMed:20458494}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapGlyma.06G154400.1.p
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankEU6619170.0EU661917.1 Glycine max NAC domain protein (NAC17) mRNA, partial cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_003526868.11e-152NAC domain-containing protein 104 isoform X1
RefseqXP_028236441.11e-152NAC domain-containing protein 104-like isoform X1
SwissprotQ8GWK65e-52NC104_ARATH; NAC domain-containing protein 104
TrEMBLA0A445KA591e-151A0A445KA59_GLYSO; NAC domain-containing protein 104 isoform A
TrEMBLI1KBK31e-151I1KBK3_SOYBN; Uncharacterized protein
STRINGGLYMA06G15990.11e-152(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF17363395
Representative plantOGRP45101024
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G64530.12e-51xylem NAC domain 1
Publications ? help Back to Top
  1. Zhao C, et al.
    XYLEM NAC DOMAIN1, an angiosperm NAC transcription factor, inhibits xylem differentiation through conserved motifs that interact with RETINOBLASTOMA-RELATED.
    New Phytol., 2017. 216(1): p. 76-89
    [PMID:28742236]
  2. Tang N, et al.
    Natural variation at XND1 impacts root hydraulics and trade-off for stress responses in Arabidopsis.
    Nat Commun, 2018. 9(1): p. 3884
    [PMID:30250259]