PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Glyma.06G149900.1.p
Common NameGLYMA_06G149900, LOC100805632
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Glycine; Soja
Family Trihelix
Protein Properties Length: 498aa    MW: 56523.9 Da    PI: 6.9569
Description Trihelix family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Glyma.06G149900.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1trihelix90.22.3e-2842127187
             trihelix   1 rWtkqevlaLiearremeerlrrgklkkplWeevskkmrergferspkqCkekwenlnkrykkikegekkrtsessstcpyfdqlea 87 
                          rW+++e++aL+++r+em+ ++++++ k+plWe+vs+k++e g++rs+k+Ckek+en+ k+++++keg+ ++ s+  +t+++f+qlea
  Glyma.06G149900.1.p  42 RWPREETMALLKIRSEMDVAFKDANPKAPLWEQVSRKLAELGYNRSAKKCKEKFENVYKYHRRTKEGRFGK-SNGAKTYRFFEQLEA 127
                          8********************************************************************97.67778********85 PP

2trihelix95.26.1e-30324415187
             trihelix   1 rWtkqevlaLiearremeerlrrgk......lkkplWeevskkmrergferspkqCkekwenlnkrykkikegekkrtsessstcpyfdq 84 
                          rW+k+ev aLi++r+e + + + ++      +k+plWee+s +m++ g+ rs+k+Ckekwen+nk++k+ike +k++ +++s+tcpy+++
  Glyma.06G149900.1.p 324 RWPKDEVEALIRLRTEFDVQAQGNNnnsnngSKGPLWEEISLAMKSIGYDRSAKRCKEKWENINKYFKRIKEKNKRK-PQDSKTCPYYHH 412
                          8**************8888887543345556********************************************96.9*********** PP

             trihelix  85 lea 87 
                          lea
  Glyma.06G149900.1.p 413 LEA 415
                          985 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS500907.6423599IPR017877Myb-like domain
SMARTSM007171.4E-439101IPR001005SANT/Myb domain
CDDcd122033.94E-2141106No hitNo description
PfamPF138371.0E-1841128No hitNo description
SMARTSM007172.3E-5321389IPR001005SANT/Myb domain
PfamPF138371.2E-20323416No hitNo description
CDDcd122034.91E-20323394No hitNo description
Gene3DG3DSA:1.10.10.602.0E-4323386IPR009057Homeodomain-like
PROSITE profilePS500907.387323387IPR017877Myb-like domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 498 aa     Download sequence    Send to blast
MLEISTLPET ATENADGGSA AVSDGSKAEH SEDGDRNSAA NRWPREETMA LLKIRSEMDV  60
AFKDANPKAP LWEQVSRKLA ELGYNRSAKK CKEKFENVYK YHRRTKEGRF GKSNGAKTYR  120
FFEQLEALDG NHSLPPPTTT TDNNNNVDDD DVILNAVPCS VIAAAAHEHS SSTTSSSGKM  180
KRKLTRFLEG LMREVIEKQE TLQRKFMEVL DKCEKDRMAR EEAWKKEELE RIKKERELLA  240
HERSIAAAKD EAVLAFLKKF AEAEGTVQLL EKIQVQNDKQ KNKHQNGANA NRGGDVTVVT  300
DMDKQECGNN GVSVGNFVHM SSSRWPKDEV EALIRLRTEF DVQAQGNNNN SNNGSKGPLW  360
EEISLAMKSI GYDRSAKRCK EKWENINKYF KRIKEKNKRK PQDSKTCPYY HHLEALYSKK  420
PKKVVDHGNE LKPEELLMHI MESQSQEQQQ EMQTQTQSSS EDAERDQDQN QDQSGYQNQM  480
VDNNNNNNSP SSIAIMS*
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Gma.370990.0cotyledon| seed coat| stem
Functional Description ? help Back to Top
Source Description
UniProtProbable transcription factor that binds specific DNA sequence. {ECO:0000250}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapGlyma.06G149900.1.p
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankEF2217530.0EF221753.1 Glycine max trihelix transcription factor (GT-2A) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_003526850.10.0trihelix transcription factor GT-2
RefseqXP_028236391.10.0trihelix transcription factor GT-2-like
SwissprotQ391174e-63TGT2_ARATH; Trihelix transcription factor GT-2
TrEMBLA0A445KA000.0A0A445KA00_GLYSO; Trihelix transcription factor GT-2 isoform A
TrEMBLI1KBF60.0I1KBF6_SOYBN; Uncharacterized protein
STRINGGLYMA06G15500.10.0(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF37334181
Representative plantOGRP6631573
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G76890.24e-56Trihelix family protein