PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Glyma.06G134600.1.p
Common NameGLYMA_06G134600, LOC100796948
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Glycine; Soja
Family GRF
Protein Properties Length: 579aa    MW: 62125.9 Da    PI: 8.8406
Description GRF family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Glyma.06G134600.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1WRC78.56.6e-25199242144
                  WRC   1 daepgrCrRtDGKkWRCsrrvlegkklCErHlhrgrsrsrkske 44 
                          d+epgrCrRtDGKkWRCsr+v +++k+CErH+hrgr rsrk++e
  Glyma.06G134600.1.p 199 DPEPGRCRRTDGKKWRCSRDVAPNHKYCERHMHRGRPRSRKPVE 242
                          79***************************************998 PP

2QLQ54.14.7e-19147179234
                  QLQ   2 aFTaaQlqlLksQilAyKyLaanqPvPpeLlqa 34 
                          +FT aQ+ +L++Q+++yKy++a++PvP++Ll +
  Glyma.06G134600.1.p 147 PFTSAQWRELERQAMIYKYMMASVPVPHDLLTP 179
                          8*****************************988 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM009516.4E-11146182IPR014978Glutamine-Leucine-Glutamine, QLQ
PROSITE profilePS5166620.567147182IPR014978Glutamine-Leucine-Glutamine, QLQ
PfamPF088809.8E-13147178IPR014978Glutamine-Leucine-Glutamine, QLQ
PROSITE profilePS5166725.739199243IPR014977WRC domain
PfamPF088792.0E-20200242IPR014977WRC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0010114Biological Processresponse to red light
GO:0010218Biological Processresponse to far red light
GO:0080167Biological Processresponse to karrikin
GO:0005634Cellular Componentnucleus
GO:0005524Molecular FunctionATP binding
Sequence ? help Back to Top
Protein Sequence    Length: 579 aa     Download sequence    Send to blast
MGELFGVGKR RNISSSNNNN NSSSSSVLGL DVKVQQSPEA LFHNRMMMMA HHNHHHRPLS  60
SPFDNNGDGD GPTTYMSFTN HINLVSGASS VLGPAIDAGC GAAPPAPVRT LQPFDISSYT  120
SSPTTTTTTF NFKPPSAGVM AASLGFPFTS AQWRELERQA MIYKYMMASV PVPHDLLTPS  180
SRSSCMDGGF NLRLANSTDP EPGRCRRTDG KKWRCSRDVA PNHKYCERHM HRGRPRSRKP  240
VEVNTNSTTT PTSVNNNNHQ IKKARHECNN NPFATPDVTA AISNPTSRKN GSSPHFLGST  300
TTQPYLDSSL SLDNFGLKAA SFDSVASVSA NKEPRGLEWM LNGDPISLGA SDSQWQSLMH  360
NKDGMTSVSS CNTTESQYLN SLALYNSGLE QQNRRHPLFL NPLVVPMENL QPEKPRGFID  420
AWSNAESNAN TNTTNKNSAA SIGKLSLSSL DLSMGGAAVN EDVGNVNMGL GLMEPNGKTH  480
TGTKISLSNW QNPAPWVASS LGGPLAEVLR SSTVTATTTT NEATSNTPSP ATTTHAESPS  540
GVLQKTLVSL SDSSNNSSPR VASSRANSEM ALLRFQSN*
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Gma.82630.0cotyledon| leaf| meristem| stem
Cis-element ? help Back to Top
SourceLink
PlantRegMapGlyma.06G134600.1.p
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_003526749.10.0growth-regulating factor 7 isoform X1
TrEMBLI1KAZ60.0I1KAZ6_SOYBN; Uncharacterized protein
STRINGGLYMA06G13960.10.0(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF73242842
Representative plantOGRP1109257
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G53660.15e-39growth-regulating factor 7