PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Glyma.06G131500.1.p
Common NameGLYMA_06G131500
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Glycine; Soja
Family Dof
Protein Properties Length: 207aa    MW: 22960.2 Da    PI: 10.0003
Description Dof family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Glyma.06G131500.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-Dof126.77.2e-403897261
               zf-Dof  2 kekalkcprCdstntkfCyynnyslsqPryfCkaCrryWtkGGalrnvPvGggrrknkks 61
                         k++al+cprC+stntkfCyynnyslsqPryfCk+CrryWt+GG+lrnvPvGgg+rknk+s
  Glyma.06G131500.1.p 38 KDQALNCPRCNSTNTKFCYYNNYSLSQPRYFCKTCRRYWTEGGSLRNVPVGGGSRKNKRS 97
                         7899******************************************************87 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
ProDomPD0074784.0E-303496IPR003851Zinc finger, Dof-type
PfamPF027013.4E-343996IPR003851Zinc finger, Dof-type
PROSITE profilePS5088429.2644296IPR003851Zinc finger, Dof-type
PROSITE patternPS0136104480IPR003851Zinc finger, Dof-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 207 aa     Download sequence    Send to blast
MDTAQWAQGI GVVKQPTMEG GSKPPPPPML ERRARPQKDQ ALNCPRCNST NTKFCYYNNY  60
SLSQPRYFCK TCRRYWTEGG SLRNVPVGGG SRKNKRSTPS APPPSSASAQ AKKLPDLTTP  120
NFPQSASQDP KIHQGQDLNL AYPPAEDYNT VSMSKLIEVP YNTELTRVAF IKTLLPHQHQ  180
HLHLLTISCL PWSFSRLGLL LLPQGV*
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Gma.286790.0stem
Expression -- Description ? help Back to Top
Source Description
UniprotDEVELOPMENTAL STAGE: Expressed at preprocambial stages first in wide domains, and later confined to sites of vein development. {ECO:0000269|PubMed:20563990}.
UniprotTISSUE SPECIFICITY: Accumulates in the stele. {ECO:0000269|PubMed:20563990}.
Functional Description ? help Back to Top
Source Description
UniProtTranscription factor that binds specifically to a 5'-AA[AG]G-3' consensus core sequence. {ECO:0000250}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapGlyma.06G131500.1.p
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankDQ8572720.0DQ857272.1 Glycine max Dof28 mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqNP_001236794.11e-119Dof21b
RefseqXP_028236145.11e-119dof zinc finger protein DOF2.5-like isoform X1
SwissprotQ8LAP88e-42DOF46_ARATH; Dof zinc finger protein DOF4.6
TrEMBLK7KUU31e-151K7KUU3_SOYBN; Uncharacterized protein
STRINGGLYMA06G13671.11e-152(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF67434137
Representative plantOGRP3817445
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G24060.14e-42Dof family protein
Publications ? help Back to Top
  1. Duarte JM, et al.
    Expression pattern shifts following duplication indicative of subfunctionalization and neofunctionalization in regulatory genes of Arabidopsis.
    Mol. Biol. Evol., 2006. 23(2): p. 469-78
    [PMID:16280546]