PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Glyma.06G124300.1.p
Common NameGLYMA_06G124300, LOC100806008
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Glycine; Soja
Family Dof
Protein Properties Length: 290aa    MW: 31796.9 Da    PI: 4.4323
Description Dof family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Glyma.06G124300.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-Dof120.37.2e-3845100661
               zf-Dof   6 lkcprCdstntkfCyynnyslsqPryfCkaCrryWtkGGalrnvPvGggrrknkks 61 
                           +cprC stntkfCyynnyslsqPryfCk+CrryWtkGG+lrnvPvGgg+rkn++ 
  Glyma.06G124300.1.p  45 PNCPRCASTNTKFCYYNNYSLSQPRYFCKGCRRYWTKGGSLRNVPVGGGCRKNRRG 100
                          68***************************************************986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
ProDomPD0074782.0E-273697IPR003851Zinc finger, Dof-type
PfamPF027015.4E-324599IPR003851Zinc finger, Dof-type
PROSITE profilePS5088428.7054599IPR003851Zinc finger, Dof-type
PROSITE patternPS0136104783IPR003851Zinc finger, Dof-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 290 aa     Download sequence    Send to blast
MFPQSFNISG GGAGLEQLLQ PHHFPSPMEQ QQQRSRWKPS VEVAPNCPRC ASTNTKFCYY  60
NNYSLSQPRY FCKGCRRYWT KGGSLRNVPV GGGCRKNRRG KSLQSSSSRQ QRASSFVSGD  120
TESSFSDAQQ INNGSRDIDM ALVFAKFLNP KPTTGEDNNG SSSTSNNFTP ESVEIENDAV  180
VQSQNKASSD PVIVESENLS LGEIDELERL LGVCGDEDGL WSDATLSSSV TWEPPLKELE  240
YSMPLNEDDD DAQLLPIITS ASTMISDSCW SNWSSFDLST MEAFSSSPS*
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Gma.223490.0flower| hypocotyl
Functional Description ? help Back to Top
Source Description
UniProtTranscription factor that binds specifically to a 5'-AA[AG]G-3' consensus core sequence. {ECO:0000250}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapGlyma.06G124300.1.p
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankDQ8572743e-98DQ857274.1 Glycine max Dof23 mRNA, partial cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_003527971.10.0dof zinc finger protein DOF3.5
RefseqXP_028236027.10.0dof zinc finger protein DOF3.5-like
SwissprotQ9SVC52e-43DOF35_ARATH; Dof zinc finger protein DOF3.5
TrEMBLA0A445K8N80.0A0A445K8N8_GLYSO; Dof zinc finger protein DOF3.5
TrEMBLK7KUP90.0K7KUP9_SOYBN; Uncharacterized protein
STRINGGLYMA06G12950.20.0(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF18173394
Representative plantOGRP3817445
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G52440.12e-41Dof family protein