PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Glyma.06G063500.1.p
Common NameGLYMA_06G063500, LOC100809002
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Glycine; Soja
Family ARR-B
Protein Properties Length: 697aa    MW: 76774.2 Da    PI: 7.0028
Description ARR-B family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Glyma.06G063500.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like89.72.6e-28204257155
              G2-like   1 kprlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55 
                          kpr++W+ eLH++Fv av+qL G++kA+Pk+il+lm+v+ Lt+e+v+SHLQkYRl
  Glyma.06G063500.1.p 204 KPRVVWSVELHRKFVAAVNQL-GIDKAVPKKILDLMNVEKLTRENVASHLQKYRL 257
                          79*******************.********************************8 PP

2Response_reg75.22.4e-25201281109
                          EEEESSSHHHHHHHHHHHHHTTCEEEEEESSHHHHHHHHHHHH..ESEEEEESSCTTSEHHHHHHHHHHHTTTSEEEEEESTTTHHHHHH CS
         Response_reg   1 vlivdDeplvrellrqalekegyeevaeaddgeealellkekd..pDlillDiempgmdGlellkeireeepklpiivvtahgeeedale 88 
                          vl vdD+p+ + +l+++l++ +y +++++ ++ +al+ll+e++  +Dl++ D+ mp+mdG++ll+     e++lp+i+++a+g+ +++ +
  Glyma.06G063500.1.p  20 VLAVDDDPTCLLVLETLLRRCQY-HATTTNQAIKALALLREHKdkFDLVISDVHMPDMDGFKLLELVGL-EMDLPVIMLSANGDTKLVMK 107
                          799********************.***************999889*******************87754.558***************** PP

                          HHHTTESEEEESS--HHHHHH CS
         Response_reg  89 alkaGakdflsKpfdpeelvk 109
                           ++ Ga d+l Kp+ +eel +
  Glyma.06G063500.1.p 108 GISHGACDYLLKPVRMEELKN 128
                          ******************986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PIRSFPIRSF0363923.4E-1701678IPR017053Response regulator B-type, plant
Gene3DG3DSA:3.40.50.23003.6E-4217153No hitNo description
SuperFamilySSF521721.17E-3517141IPR011006CheY-like superfamily
SMARTSM004484.0E-3118130IPR001789Signal transduction response regulator, receiver domain
PROSITE profilePS5011042.86819134IPR001789Signal transduction response regulator, receiver domain
PfamPF000721.7E-2220128IPR001789Signal transduction response regulator, receiver domain
CDDcd001561.26E-2621134No hitNo description
PROSITE profilePS5129411.959201260IPR017930Myb domain
Gene3DG3DSA:1.10.10.602.5E-30201262IPR009057Homeodomain-like
SuperFamilySSF466891.09E-19202261IPR009057Homeodomain-like
TIGRFAMsTIGR015575.0E-25204257IPR006447Myb domain, plants
PfamPF002491.3E-6206256IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0000160Biological Processphosphorelay signal transduction system
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 697 aa     Download sequence    Send to blast
MTVEKKMNDS GDEFPVGMRV LAVDDDPTCL LVLETLLRRC QYHATTTNQA IKALALLREH  60
KDKFDLVISD VHMPDMDGFK LLELVGLEMD LPVIMLSANG DTKLVMKGIS HGACDYLLKP  120
VRMEELKNIW QHVIRRKKFD SKEKNKTRNI DKPTSNSSNG LGSSGTGNSD HNEKLTKKRK  180
DQDEDEDEEQ ENDHDNDDPS AQKKPRVVWS VELHRKFVAA VNQLGIDKAV PKKILDLMNV  240
EKLTRENVAS HLQKYRLYLK RISCVANQQT NMVVALGGAD PSYLRMNSVS GVGHIQSISG  300
SGQLHNNAFR SFPPSGIINR LNTPAGLNVH GFPSGVLQLS QSQNLKNTND NLKFQSAIVP  360
ANQNGVHGMT VSVGLDQLQN NKGVMSVQNL TTVFDAKTTF PISNKLPDPR PKITNSGSHT  420
PDVSFSNNAL MLEPRPQGTQ GSVRIETLSS SVASQHSEFS LSLLDQGRYS DNWASTVQPS  480
VIQTNSYPPS ECFGQTNIPP TDNMASVPLQ GGNLSGASIT SLSRQSYDSM TDMHSEGVTF  540
TNRPGHISSN VPYQGWHDNN QDATHHSNIL SINSLTPVNG AAVPAGHAAM NSALHRNLDF  600
NYCDPLQMKH EGFVELTDEA LSKQHQGNIM NLPKSQQSHF SNNLGSLEDL VSSMMKQEND  660
KMKLLDGNLI CNNYSGGLSR CDSRFSSTFQ NIMHPR*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1irz_A6e-26200263164ARR10-B
Search in ModeBase
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Gma.196740.0root| stem
Functional Description ? help Back to Top
Source Description
UniProtTranscriptional activator that binds specific DNA sequence. Functions as a response regulator involved in His-to-Asp phosphorelay signal transduction system. Phosphorylation of the Asp residue in the receiver domain activates the ability of the protein to promote the transcription of target genes. May directly activate some type-A response regulators in response to cytokinins. {ECO:0000250|UniProtKB:Q940D0}.
UniProtTranscriptional activator that binds specific DNA sequence. Functions as a response regulator involved in His-to-Asp phosphorelay signal transduction system. Phosphorylation of the Asp residue in the receiver domain activates the ability of the protein to promote the transcription of target genes. May directly activate some type-A response regulators in response to cytokinins. {ECO:0000250|UniProtKB:Q940D0}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapGlyma.06G063500.1.p
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankBT0938360.0BT093836.1 Soybean clone JCVI-FLGm-24O12 unknown mRNA.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_003526216.10.0two-component response regulator ARR12
SwissprotB8AEH11e-142ORR23_ORYSI; Two-component response regulator ORR23
SwissprotQ6K8X61e-142ORR23_ORYSJ; Two-component response regulator ORR23
TrEMBLI1K8P70.0I1K8P7_SOYBN; Two-component response regulator
STRINGGLYMA06G06730.10.0(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF95634112
Representative plantOGRP29217120
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G25180.11e-129response regulator 12
Publications ? help Back to Top
  1. Kikuchi S, et al.
    Collection, mapping, and annotation of over 28,000 cDNA clones from japonica rice.
    Science, 2003. 301(5631): p. 376-9
    [PMID:12869764]