PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Glyma.06G008800.1.p
Common NameGLYMA_06G008800, LOC100780311
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Glycine; Soja
Family GATA
Protein Properties Length: 295aa    MW: 32887.9 Da    PI: 7.1159
Description GATA family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Glyma.06G008800.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GATA572.6e-18211244134
                 GATA   1 CsnCgttkTplWRrgpdgnktLCnaCGlyyrkkg 34 
                          Cs+C++ kTp+WR gp g ktLCnaCG++y++ +
  Glyma.06G008800.1.p 211 CSHCQVQKTPQWRTGPLGAKTLCNACGVRYKSGR 244
                          *******************************987 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PIRSFPIRSF0169924.6E-7918293IPR016679Transcription factor, GATA, plant
SMARTSM004019.2E-13205259IPR000679Zinc finger, GATA-type
SuperFamilySSF577161.28E-13205266No hitNo description
Gene3DG3DSA:3.30.50.101.5E-14209242IPR013088Zinc finger, NHR/GATA-type
PROSITE profilePS5011411.332209241IPR000679Zinc finger, GATA-type
CDDcd002026.87E-14210267No hitNo description
PROSITE patternPS003440211236IPR000679Zinc finger, GATA-type
PfamPF003203.5E-16211244IPR000679Zinc finger, GATA-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0007623Biological Processcircadian rhythm
GO:0009416Biological Processresponse to light stimulus
GO:0030154Biological Processcell differentiation
GO:0045944Biological Processpositive regulation of transcription from RNA polymerase II promoter
GO:0005634Cellular Componentnucleus
GO:0005667Cellular Componenttranscription factor complex
GO:0000977Molecular FunctionRNA polymerase II regulatory region sequence-specific DNA binding
GO:0001085Molecular FunctionRNA polymerase II transcription factor binding
GO:0001228Molecular Functiontranscriptional activator activity, RNA polymerase II transcription regulatory region sequence-specific binding
GO:0003682Molecular Functionchromatin binding
GO:0008270Molecular Functionzinc ion binding
Sequence ? help Back to Top
Protein Sequence    Length: 295 aa     Download sequence    Send to blast
MEVAVAKALK PSLRSEFIVQ KMHCEDIFSL NANTVAVGED FSVDDLFDFS NGSLHNEHQQ  60
ECDEEKQSLS ASSQSQDRGE DDSNSNSTGV SYDSLFSTEL AVPAGDLEDL EWVSHFVDDS  120
LPELSLLYPV RSEEANRFVE PEPSVKKTPR FPWEMKITSK ARSVRNRKPN TRVWSLGSTL  180
LSLPSSPPAK KQKKRAEAQV QPVGVQIQRR CSHCQVQKTP QWRTGPLGAK TLCNACGVRY  240
KSGRLFSEYR PACSPTFCSD IHSNSHRKVL EIRKRKEVAE PDTGLAQTQM VPTC*
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Gma.551870.0cotyledon| flower| leaf| meristem| pod| root| stem
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAC2352871e-114AC235287.1 Glycine max strain Williams 82 clone GM_WBb0053I09, complete sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_003527135.10.0PREDICTED: GATA transcription factor 7-like
TrEMBLI1K7300.0I1K730_SOYBN; Uncharacterized protein
STRINGGLYMA06G01110.10.0(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP6817287
FabidsOGEF110834107
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G36240.12e-55GATA transcription factor 7