PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Glyma.05G204100.5.p
Common NameGLYMA_05G204100, LOC100806507
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Glycine; Soja
Family SBP
Protein Properties Length: 391aa    MW: 42729.5 Da    PI: 8.3418
Description SBP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Glyma.05G204100.5.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SBP131.43.2e-4195171278
                          -SSTT-----TT--HHHHHTT--HHHHT-S-EEETTEEEEE-TTTSSEEETTT--SS--S-STTTT-------S--- CS
                  SBP   2 CqvegCeadlseakeyhrrhkvCevhskapvvlvsgleqrfCqqCsrfhelsefDeekrsCrrrLakhnerrrkkqa 78 
                          C v+gC+adls++++yhrrhkvCevhsk+++v + g++qrfCqqCsrfh+l+efDe+krsCr+rL++hn+rrrk+q+
  Glyma.05G204100.5.p  95 CLVDGCHADLSNCRDYHRRHKVCEVHSKTAQVSIGGQKQRFCQQCSRFHSLEEFDEGKRSCRKRLDGHNRRRRKPQP 171
                          **************************************************************************997 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:4.10.1100.106.7E-3488156IPR004333Transcription factor, SBP-box
PROSITE profilePS5114131.87292169IPR004333Transcription factor, SBP-box
SuperFamilySSF1036122.88E-3893174IPR004333Transcription factor, SBP-box
PfamPF031102.1E-3095168IPR004333Transcription factor, SBP-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0048653Biological Processanther development
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 391 aa     Download sequence    Send to blast
MDWNLKALSW DLSEVDQANL PNMETMEGSS RYGMYRTKGE FSVDLKLGQV GNSGTESVLT  60
KSKDAVGVSK MTSSSTSGSS KRARALSNGT QTVSCLVDGC HADLSNCRDY HRRHKVCEVH  120
SKTAQVSIGG QKQRFCQQCS RFHSLEEFDE GKRSCRKRLD GHNRRRRKPQ PESLTRSGSF  180
LSNYQGTQLL PFSSSHEYPS TTVVNPTWGG VLTTSGDVRL HGHNQHHHQV HLADKQDLFL  240
GSSPAGYKEG KQLAFMQGDH TLNNRSPHLP GASVGQAQMF LRTSLYSESD GLRCKMFCDS  300
LTSSIQDNNT SRALSLLSSP PQPLSPGNGL NLMVNSHSPL MQPLGLSLHD NSLGSVDPVL  360
GPNDSSSMYN IGSNGSQGNE APPLFPFQWE *
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ul4_A1e-28951681184squamosa promoter binding protein-like 4
Search in ModeBase
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1151168KRSCRKRLDGHNRRRRKP
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Gma.376300.0flower| meristem
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00555DAPTransfer from AT5G50570Download
Motif logo
Cis-element ? help Back to Top
SourceLink
PlantRegMapGlyma.05G204100.5.p
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAP0150341e-155AP015034.1 Vigna angularis var. angularis DNA, chromosome 1, almost complete sequence, cultivar: Shumari.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_003525416.10.0squamosa promoter-binding-like protein 13A isoform X2
RefseqXP_014631309.10.0squamosa promoter-binding-like protein 13A isoform X2
TrEMBLI1K6N70.0I1K6N7_SOYBN; Uncharacterized protein
STRINGGLYMA05G38180.80.0(Glycine max)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G50670.12e-74SBP family protein