PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Glyma.05G192500.1.p
Common NameGLYMA_05G192500, LOC100779578
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Glycine; Soja
Family NAC
Protein Properties Length: 207aa    MW: 23046.9 Da    PI: 4.4547
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Glyma.05G192500.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM105.75.9e-3391251128
                  NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpkkvkaeekewyfFskrdkkyatgkrknratksgyWkatgkdk 90 
                          lppGf F+Ptdeelv ++L+ k++   ++   +i+e+d+  ++Pw+L+ k+ ++ ++ yfF+k         ++nr+t++gyWk+ g  +
  Glyma.05G192500.1.p   9 LPPGFCFSPTDEELVLHFLCSKASLPCHPN--IIPELDLSLLDPWELNGKALSSGNQHYFFTKV--------KENRSTENGYWKEIGVME 88 
                          79********************98776555..8**************97777788999***986........45899************* PP

                  NAM  91 evlskkgelvglkktLvfykgrapkgektdWvmheyrl 128
                          +++s ++e+vg+kk Lvf  g+ap+g++t+Wvm+ey++
  Glyma.05G192500.1.p  89 PIVS-SSEKVGIKKYLVFNLGEAPQGTETSWVMQEYHI 125
                          ****.9999***************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019411.44E-403162IPR003441NAC domain
PROSITE profilePS5100537.8539162IPR003441NAC domain
PfamPF023651.0E-1910125IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 207 aa     Download sequence    Send to blast
MMACGSVNLP PGFCFSPTDE ELVLHFLCSK ASLPCHPNII PELDLSLLDP WELNGKALSS  60
GNQHYFFTKV KENRSTENGY WKEIGVMEPI VSSSEKVGIK KYLVFNLGEA PQGTETSWVM  120
QEYHICSSGF NTTTASNCAS TRGRRKTDQC GSKWVLCKAY EKKSCQSQQG VNCYSDEDDC  180
GTELSWLDEF YMSLDDDLEE VMSLPS*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3ulx_A2e-3531649170Stress-induced transcription factor NAC1
Search in ModeBase
Expression -- Description ? help Back to Top
Source Description
UniprotTISSUE SPECIFICITY: Expressed in root xylem vessels (PubMed:15923329). Expressed in stems, vascular tissue of cauline leaves and tracheary elements of sepals (PubMed:18069942). {ECO:0000269|PubMed:15923329, ECO:0000269|PubMed:18069942}.
Functional Description ? help Back to Top
Source Description
UniProtProbable transcription factor that influences tracheary elements and xylem development by negatively regulating secondary cell wall fiber synthesis and programmed cell death. {ECO:0000269|PubMed:18069942, ECO:0000269|PubMed:20458494}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapGlyma.05G192500.1.p
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAP0150345e-78AP015034.1 Vigna angularis var. angularis DNA, chromosome 1, almost complete sequence, cultivar: Shumari.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_003524308.21e-154NAC domain-containing protein 104
RefseqXP_028233299.11e-154NAC domain-containing protein 104-like
SwissprotQ8GWK64e-56NC104_ARATH; NAC domain-containing protein 104
TrEMBLA0A0B2RLL31e-152A0A0B2RLL3_GLYSO; NAC domain-containing protein 104
TrEMBLA0A0R4J3E21e-152A0A0R4J3E2_SOYBN; Uncharacterized protein
STRINGGLYMA05G32590.21e-153(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF17363395
Representative plantOGRP45101024
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G64530.12e-58xylem NAC domain 1
Publications ? help Back to Top
  1. Zhao C, et al.
    XYLEM NAC DOMAIN1, an angiosperm NAC transcription factor, inhibits xylem differentiation through conserved motifs that interact with RETINOBLASTOMA-RELATED.
    New Phytol., 2017. 216(1): p. 76-89
    [PMID:28742236]
  2. Tang N, et al.
    Natural variation at XND1 impacts root hydraulics and trade-off for stress responses in Arabidopsis.
    Nat Commun, 2018. 9(1): p. 3884
    [PMID:30250259]