PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Glyma.05G140400.1.p
Common NameGAIL, GLYMA_05G140400
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Glycine; Soja
Family GRAS
Protein Properties Length: 524aa    MW: 57870.2 Da    PI: 5.1485
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Glyma.05G140400.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS453.51.3e-1381585131374
                 GRAS   1 lvelLlecAeavssgdlelaqalLarlselaspdgdpmqRlaayfteALaarlarsvselykalppsetseknsseelaalklfsevsPi 90 
                          lv+ L++cAeav++++l+ a+al++++  la ++  +m+++a+yf+eALa+r++r        + p++ s    s++l++   f+e++P+
  Glyma.05G140400.1.p 158 LVHSLMACAEAVENNNLAVAEALVKQIGFLALSQVGAMRKVATYFAEALARRIYR--------VFPQQHS---LSDSLQI--HFYETCPY 234
                          689****************************************************........4444444...6666555..4******* PP

                 GRAS  91 lkfshltaNqaIleavegeervHiiDfdisqGlQWpaLlqaLasRpegppslRiTgvgspesgskeeleetgerLakfAeelgvpfefnv 180
                          lkf+h+taNqaIlea++g++rvH+iDf+i+qG+QWpaL+qaLa R++gpp +R+Tg+g+p++++++ l+e+g++La++Ae+++v+fe++ 
  Glyma.05G140400.1.p 235 LKFAHFTANQAILEAFQGKNRVHVIDFGINQGMQWPALMQALALRNDGPPVFRLTGIGPPAADNSDHLQEVGWKLAQLAERIHVQFEYRG 324
                          ****************************************************************************************** PP

                 GRAS 181 lvakrledleleeLrvkpgEalaVnlvlqlhrlldesvsleserdevLklvkslsPkvvvvveqeadhnsesFlerflealeyysalfds 270
                          +va++l+dl+ ++L+++++E++aVn+v++ h+ll++++++e+    vL++v++++P++++vveqea+hn+ sF++rf+e+l+yys+lfds
  Glyma.05G140400.1.p 325 FVANSLADLDASMLDLREDESVAVNSVFEFHKLLARPGAVEK----VLSVVRQIRPEILTVVEQEANHNGLSFVDRFTESLHYYSTLFDS 410
                          ******************************************....******************************************** PP

                 GRAS 271 leaklpreseerikvErellgreivnvvacegaerrerhetlekWrerleeaGFkpvplsekaakqaklllrkvk.sdgyrveeesgslv 359
                          le +  + + +++ +++++lg++i+nvvaceg +r+erhetl++Wr+r+++ GF+pv+l+++a+kqa++ll+ ++ +dgyrvee++g+l+
  Glyma.05G140400.1.p 411 LEGS--PVNPNDKAMSEVYLGKQICNVVACEGMDRVERHETLNQWRNRFGSTGFSPVHLGSNAYKQASMLLSLFGgGDGYRVEENNGCLM 498
                          *999..67889999999************************************************************************* PP

                 GRAS 360 lgWkdrpLvsvSaWr 374
                          lgW++rpL+++S+W+
  Glyma.05G140400.1.p 499 LGWHTRPLIATSVWQ 513
                          **************6 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS512577117No hitNo description
SMARTSM011292.4E-3134106No hitNo description
PfamPF120411.2E-3234100IPR021914Transcriptional factor DELLA, N-terminal
PROSITE profilePS5098565.901132492IPR005202Transcription factor GRAS
PfamPF035144.5E-136158513IPR005202Transcription factor GRAS
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0006808Biological Processregulation of nitrogen utilization
GO:0009723Biological Processresponse to ethylene
GO:0009737Biological Processresponse to abscisic acid
GO:0009863Biological Processsalicylic acid mediated signaling pathway
GO:0009867Biological Processjasmonic acid mediated signaling pathway
GO:0009938Biological Processnegative regulation of gibberellic acid mediated signaling pathway
GO:0010187Biological Processnegative regulation of seed germination
GO:0010218Biological Processresponse to far red light
GO:0010233Biological Processphloem transport
GO:0042538Biological Processhyperosmotic salinity response
GO:2000033Biological Processregulation of seed dormancy process
GO:2000377Biological Processregulation of reactive oxygen species metabolic process
GO:0005634Cellular Componentnucleus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 524 aa     Download sequence    Send to blast
MKRERQQLGS NAGTSSCGYS SGKSNLWEEE GGMDELLAVV GYKVRSSDMA EVAQKLERLE  60
EAMGNVQDDL TDLSNDAVHY NPSDISNWLQ TMLSNFDPLP SEEPEKDSAS SDYDLKAIPG  120
KAIYGGGSDA LPNPKRVRTD ESTRAVVVVD LQENGIRLVH SLMACAEAVE NNNLAVAEAL  180
VKQIGFLALS QVGAMRKVAT YFAEALARRI YRVFPQQHSL SDSLQIHFYE TCPYLKFAHF  240
TANQAILEAF QGKNRVHVID FGINQGMQWP ALMQALALRN DGPPVFRLTG IGPPAADNSD  300
HLQEVGWKLA QLAERIHVQF EYRGFVANSL ADLDASMLDL REDESVAVNS VFEFHKLLAR  360
PGAVEKVLSV VRQIRPEILT VVEQEANHNG LSFVDRFTES LHYYSTLFDS LEGSPVNPND  420
KAMSEVYLGK QICNVVACEG MDRVERHETL NQWRNRFGST GFSPVHLGSN AYKQASMLLS  480
LFGGGDGYRV EENNGCLMLG WHTRPLIATS VWQLATKSVV AAH*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5hyz_A4e-531585134375GRAS family transcription factor containing p
Search in ModeBase
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Gma.25330.0cotyledon| epicotyl| hypocotyl| leaf| pod| root| somatic embryo| stem
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankEU2525730.0EU252573.1 Glycine max gibberellin insensitive-like protein (GAIL) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqNP_001240948.10.0DELLA protein GAI 1
SwissprotQ5BN220.0RGA2_BRACM; DELLA protein RGA2
TrEMBLE3NYP40.0E3NYP4_SOYBN; Gibberellin insensitive-like protein
STRINGGLYMA05G27190.10.0(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP12511550
FabidsOGEF80334121
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G14920.10.0GRAS family protein
Publications ? help Back to Top
  1. Bassel GW,Zielinska E,Mullen RT,Bewley JD
    Down-regulation of DELLA genes is not essential for germination of tomato, soybean, and Arabidopsis seeds.
    Plant Physiol., 2004. 136(1): p. 2782-9
    [PMID:15347801]
  2. Luo J, et al.
    A DELLA gene, RhGAI1, is a direct target of EIN3 and mediates ethylene-regulated rose petal cell expansion via repressing the expression of RhCesA2.
    J. Exp. Bot., 2013. 64(16): p. 5075-84
    [PMID:24014864]