PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Glyma.05G140000.1.p
Common NameGLYMA_05G140000, LOC102660566
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Glycine; Soja
Family M-type_MADS
Protein Properties Length: 314aa    MW: 36264.4 Da    PI: 9.0823
Description M-type_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Glyma.05G140000.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF511.9e-161151343
                         --SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TT CS
               SRF-TF  3 ienksnrqvtfskRrngilKKAeELSvLCdaevaviifsst 43
                         i+ +  r+ tf kR++g+lKKA+E+S+LC+++v ++i++++
  Glyma.05G140000.1.p 11 IQKEKARKKTFDKRKKGLLKKAYEISTLCAVDVGIVIYAPK 51
                         777888999*****************************986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM004322.3E-16161IPR002100Transcription factor, MADS-box
PROSITE profilePS5006619.147151IPR002100Transcription factor, MADS-box
SuperFamilySSF554553.4E-20298IPR002100Transcription factor, MADS-box
CDDcd002662.24E-19275No hitNo description
PRINTSPR004044.5E-9323IPR002100Transcription factor, MADS-box
PfamPF003191.8E-161150IPR002100Transcription factor, MADS-box
PRINTSPR004044.5E-92338IPR002100Transcription factor, MADS-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 314 aa     Download sequence    Send to blast
MGRGRIPMEL IQKEKARKKT FDKRKKGLLK KAYEISTLCA VDVGIVIYAP KFLNEPETWP  60
QDQDSREVKR IIQKYQNTTS DRYSKMYNVQ EYFNDRMKKI EGEISKVHKE KIKLMYPTWD  120
DSYNTLGEEQ LRMFVSILDV KLDACNQRMN MLKRDSKGKR ITKSDKTQTL TPCMTSNFMS  180
QTQQLFPSSD NNQVAFYPCQ LSQSSQPSMF HFGQSCMQFM EKNAMVDWAN QVGVGACDPK  240
MGVLKEDGSD KNQNSSPCYN GNMQTLPSQL QYDATFQTLP NQLEQPSGVE LNGFYDSNML  300
QLSQFFNYMH GRK*
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
11425KARKKTFDKRKK
Cis-element ? help Back to Top
SourceLink
PlantRegMapGlyma.05G140000.1.p
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006580847.10.0agamous-like MADS-box protein AGL82
RefseqXP_028230852.10.0agamous-like MADS-box protein AGL82
TrEMBLA0A445KNN20.0A0A445KNN2_GLYSO; Agamous-like MADS-box protein AGL82
STRINGGLYMA05G27105.10.0(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF53431111
Representative plantOGRP3677621
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G55690.12e-14M-type_MADS family protein