PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Glyma.05G103400.1.p
Common NameGLYMA_05G103400
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Glycine; Soja
Family GRAS
Protein Properties Length: 526aa    MW: 58423.6 Da    PI: 6.8563
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Glyma.05G103400.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS290.35.1e-891035222373
                 GRAS   2 velLlecAeavssgdlelaqalLarlselaspdgdpmqRlaayfteALaarlarsvselykalppsetsekn.sseelaalkl..fsevs 88 
                          ++lL++cA+a++++d +laq++L+ l+++a pdgd++qRla+ f++AL ar a+  ++++k l p   ++ +  ++++++ +l  f++++
  Glyma.05G103400.1.p 103 EQLLVHCANAIETNDVTLAQQILWVLNNIAPPDGDSNQRLASGFLRALTARAAK--TGTCKMLVPAGGTNLSiDTHRFNVIELanFVDLT 190
                          79****************************************************..88888887766654443666666767689***** PP

                 GRAS  89 PilkfshltaNqaIleavegeervHiiDfdisqGlQWpaLlqaLasRp...egppslRiTgvgspesg......skeeleetgerLakfA 169
                          P+++f++ +aN aIlea+eg + +Hi+D+++++++Q p+L +a+asR+    +pp +++T+ ++++           ++ e+g +L +fA
  Glyma.05G103400.1.p 191 PWHRFGFTAANAAILEATEGFSVIHIVDLSLTHCMQIPTLVDAIASRNyheVPPPIIKLTVAADASFRdnippmLDLSYDELGAKLVNFA 280
                          ************************************************8888899********97765888987778999********** PP

                 GRAS 170 eelgvpfefnvl.......vakrledleleeLrvkp.............gEalaVnlvlqlhrll......................... 214
                          ++ ++ +ef+v+            +   +e+Lrv++              Eal++n++++lh+++                         
  Glyma.05G103400.1.p 281 RSRNMVMEFRVVsssyrdgF----AG-LIEHLRVQQqhfvyaaesrttpSEALVINCHMMLHYIPdetlsdttgltsflydssslaassa 365
                          ***********855533331....22.3566655555555555666666*************************************9985 PP

                 GRAS 215 desvsleserdevLklvkslsPkvvvvveqeadhnsesFlerflealeyysalfdsleaklpreseerikvErellgreivnvvacegae 304
                           + ++++s r+ +Lk +++l P+vv++v+++ad++s++++ r+ +a++y +  +d++++ lpr s++r+++E+  + ++i+nv+a+eg +
  Glyma.05G103400.1.p 366 VSVTPTSSLRSLFLKSLRGLDPTVVILVDEDADLTSNNLVCRLRSAFNYLWIPYDTVDTFLPRGSKQRQWYEAD-ICWKIENVIAHEGVQ 454
                          33444555899***************************************************************.*************** PP

                 GRAS 305 rrerhetlekWrerleeaGFkpvplsekaakqaklllrkvksdgyrveeesgslvlgWkdrpLvsvSaW 373
                          r+er e +++W++r+++a F+ v++se+ ++++k++l +++  g+ +++e++ +vl+Wk++++v++SaW
  Glyma.05G103400.1.p 455 RVERVEPKNRWEQRMKNASFQGVAFSEDSVAEVKAMLDEHA-AGWGLKKEDEHIVLTWKGHNVVFASAW 522
                          *****************************************.999************************ PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5098542.53476504IPR005202Transcription factor GRAS
PfamPF035141.8E-86103522IPR005202Transcription factor GRAS
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
Sequence ? help Back to Top
Protein Sequence    Length: 526 aa     Download sequence    Send to blast
MTRERVSQKL NCLKSLPQCP PLHDKIPTPI YKQFDGRLLH MPPKSNTSSA SYGYSQFHPQ  60
QPGSLFPKAK VPTTTTSPRP WACTCFPTTS KALSNFGDAN CMEQLLVHCA NAIETNDVTL  120
AQQILWVLNN IAPPDGDSNQ RLASGFLRAL TARAAKTGTC KMLVPAGGTN LSIDTHRFNV  180
IELANFVDLT PWHRFGFTAA NAAILEATEG FSVIHIVDLS LTHCMQIPTL VDAIASRNYH  240
EVPPPIIKLT VAADASFRDN IPPMLDLSYD ELGAKLVNFA RSRNMVMEFR VVSSSYRDGF  300
AGLIEHLRVQ QQHFVYAAES RTTPSEALVI NCHMMLHYIP DETLSDTTGL TSFLYDSSSL  360
AASSAVSVTP TSSLRSLFLK SLRGLDPTVV ILVDEDADLT SNNLVCRLRS AFNYLWIPYD  420
TVDTFLPRGS KQRQWYEADI CWKIENVIAH EGVQRVERVE PKNRWEQRMK NASFQGVAFS  480
EDSVAEVKAM LDEHAAGWGL KKEDEHIVLT WKGHNVVFAS AWLPA*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5b3g_B3e-458752472474Protein SHORT-ROOT
5b3h_B1e-458752418420Protein SHORT-ROOT
5b3h_E1e-458752418420Protein SHORT-ROOT
Search in ModeBase
Expression -- Description ? help Back to Top
Source Description
UniprotTISSUE SPECIFICITY: Expressed in seedlings, leaves and flowers. {ECO:0000269|PubMed:18500650}.
Functional Description ? help Back to Top
Source Description
UniProtProbable transcription factor involved in plant development. {ECO:0000250}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapGlyma.05G103400.1.p
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_028232172.10.0scarecrow-like protein 32
SwissprotQ9SN221e-174SCL32_ARATH; Scarecrow-like protein 32
TrEMBLA0A0R0JYL30.0A0A0R0JYL3_SOYBN; Uncharacterized protein
STRINGGLYMA05G22140.10.0(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF77023347
Representative plantOGRP24991534
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G49950.11e-168GRAS family protein