PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Glyma.05G088300.1.p
Common NameGLYMA_05G088300, LOC100782985
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Glycine; Soja
Family GeBP
Protein Properties Length: 388aa    MW: 43230.8 Da    PI: 9.7506
Description GeBP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Glyma.05G088300.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF573101.76.3e-32172267297
               DUF573   2 lfqrlwseeDeivlLqGlidfkaktgkspsddidafyefvkksisfkvsksqlveKirrLKkKfkkkvkkaksgkepsfskehdqkifel 91 
                          l+qrl+s+eDe+++L+G+ +f +ktg++p++  daf +fvk+s+ +++s++q+ eKirrLKkKf++k ++ak+ ++p+fsk hd+ +fel
  Glyma.05G088300.1.p 172 LSQRLFSKEDELAILKGMAEFISKTGQDPYKYADAFQNFVKNSLRVEASSNQIKEKIRRLKKKFETKAQRAKKWEDPEFSKFHDRTVFEL 261
                          78**************************************************************************************** PP

               DUF573  92 skkiWg 97 
                          skk+Wg
  Glyma.05G088300.1.p 262 SKKVWG 267
                          *****8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF045041.2E-28174267IPR007592Protein of unknown function DUF573
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005730Cellular Componentnucleolus
GO:0005829Cellular Componentcytosol
GO:0009507Cellular Componentchloroplast
GO:0044212Molecular Functiontranscription regulatory region DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 388 aa     Download sequence    Send to blast
MMSSDRITLK IGPPLLFSFP GEVRGFYLVS AFLHQKQLPP PIEASSDEEQ RPSSKQHTEE  60
GVSSSEEASS QEEDDDDQPP TLPLASANPH PKPSSSDSDT DFEPTKVKPK PTDQAQKPQP  120
SPAPPKWGSK RPAQNNAPAT DPKRAKKKLT NSSSAAAAHE TEEKSGGGQA KLSQRLFSKE  180
DELAILKGMA EFISKTGQDP YKYADAFQNF VKNSLRVEAS SNQIKEKIRR LKKKFETKAQ  240
RAKKWEDPEF SKFHDRTVFE LSKKVWGEGA NGLVEKPKPN NGKRKTAKTP KKDATSRNVV  300
AKSETTTLLE SMELEECGNV NLLYREVSGF KELNEDEMKR GLALIGESKR KELEGKWRKL  360
RLAEMELVAN RSLLIGEQIK LIFEALQ*
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1141148PKRAKKKL
Cis-element ? help Back to Top
SourceLink
PlantRegMapGlyma.05G088300.1.p
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_014631045.10.0GLABROUS1 enhancer-binding protein-like
TrEMBLK7KNV70.0K7KNV7_SOYBN; Uncharacterized protein
STRINGGLYMA05G12406.10.0(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF18313490
Representative plantOGRP4222523
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G25210.12e-27DNA-binding storekeeper protein-related transcriptional regulator