PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Glyma.05G064800.1.p
Common NameGLYMA_05G064800, LOC100799745
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Glycine; Soja
Family GATA
Protein Properties Length: 543aa    MW: 60174.5 Da    PI: 6.7439
Description GATA family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Glyma.05G064800.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GATA49.94.3e-16741135
                 GATA  1 CsnCgttkTplWRrgpdgnktLCnaCGlyyrkkgl 35
                         C +Cg+t+TplWR+gp  ++ LCnaCG ++r kg+
  Glyma.05G064800.1.p  7 CYHCGVTSTPLWRNGPPEKPVLCNACGSRWRTKGT 41
                         ****************88888***********997 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM004013.3E-9153IPR000679Zinc finger, GATA-type
SuperFamilySSF577161.57E-11546No hitNo description
CDDcd002024.68E-17655No hitNo description
Gene3DG3DSA:3.30.50.102.3E-12741IPR013088Zinc finger, NHR/GATA-type
PROSITE profilePS5011411.2740IPR000679Zinc finger, GATA-type
PfamPF003207.1E-14741IPR000679Zinc finger, GATA-type
PROSITE patternPS003440732IPR000679Zinc finger, GATA-type
PfamPF139191.2E-8287377IPR028020ASX homology domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0030154Biological Processcell differentiation
GO:0045944Biological Processpositive regulation of transcription from RNA polymerase II promoter
GO:0005634Cellular Componentnucleus
GO:0005667Cellular Componenttranscription factor complex
GO:0000977Molecular FunctionRNA polymerase II regulatory region sequence-specific DNA binding
GO:0001085Molecular FunctionRNA polymerase II transcription factor binding
GO:0001228Molecular Functiontranscriptional activator activity, RNA polymerase II transcription regulatory region sequence-specific binding
GO:0003682Molecular Functionchromatin binding
GO:0008270Molecular Functionzinc ion binding
Sequence ? help Back to Top
Protein Sequence    Length: 543 aa     Download sequence    Send to blast
MGKQGPCYHC GVTSTPLWRN GPPEKPVLCN ACGSRWRTKG TLANYTPLHA RAENVDYEDQ  60
KVSRVKSISL NKNKEVKLAK RKQNYDNAAS GGFVPDYSQG YQKVVDEDTS NRSSSGSAVS  120
NSESCAQFGG TDASDLTGPA QSVVWDAMVP SKKRTCAGRP KPSSVEKLTR DLCTILHEQQ  180
SYFSASSEED LLFESDTPMV SVEIGHGSIL IRHPSSIARD EESEASSLSV DNKQCLMNEA  240
YSFSSTIPMY SDRSGMNFSS HGVEKIKNSA GQIMKQEKLE RDKSQLEKLQ VPGNHDSPLC  300
SIDLNDVVNY EEFMRNLTNE EQQQLLKYLP VVDTAKFPDS LRNMFNSFQF KENLIYFQQL  360
LGEGVFDISL LGAKPEEWKT LKRLALSNLS KSKWVEHYNF LKKCENKSGK SIGLGSTAME  420
SSYVTTAKRM REHDSQNQNF PELKTTMRSP KRVFIKPSCE VKEVVEEGSS FSPKSLFALP  480
HGVGSLHMLD SFNFVGESSE DLLLEVPSNS SFPQAELLHP SLSYGAQVST TSSSVHSLVT  540
HP*
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Gma.614110.0hypocotyl
Functional Description ? help Back to Top
Source Description
UniProtTranscriptional regulator that specifically binds 5'-GATA-3' or 5'-GAT-3' motifs within gene promoters. {ECO:0000250}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapGlyma.05G064800.1.p
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAP0150341e-172AP015034.1 Vigna angularis var. angularis DNA, chromosome 1, almost complete sequence, cultivar: Shumari.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_003524128.10.0GATA transcription factor 26
RefseqXP_028231829.10.0GATA transcription factor 26-like
SwissprotQ8W4H11e-153GAT26_ARATH; GATA transcription factor 26
TrEMBLA0A445KK780.0A0A445KK78_GLYSO; GATA transcription factor 26
TrEMBLI1K0V30.0I1K0V3_SOYBN; Uncharacterized protein
STRINGGLYMA05G05320.10.0(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF44243155
Representative plantOGRP27491530
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G17570.31e-155GATA transcription factor 26