PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Glyma.05G049300.1.p
Common NameGLYMA_05G049300, LOC100786173
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Glycine; Soja
Family GRAS
Protein Properties Length: 665aa    MW: 73760.4 Da    PI: 6.4223
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Glyma.05G049300.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS416.91.8e-1272756471373
                 GRAS   1 lvelLlecAeavssgdlelaqalLarlselaspdg.dpmqRlaayfteALaarlarsvselykalppsetsekn.sseelaalklfsevs 88 
                          lv+lL+ c++a+ s++ +++++++a+l +lasp+g +++ R+ ayfteALa r++r +++++++ ++++++++   +e+++a++l+++v+
  Glyma.05G049300.1.p 275 LVSLLTGCVDAIGSRNVTAINHFIAKLGDLASPKGtTSISRICAYFTEALAIRVTRLWPHVFHITTTTTSRDMVeDDESATAMRLLNQVT 364
                          6899*******************************99**************************9999999887757788999******** PP

                 GRAS  89 PilkfshltaNqaIleavegeervHiiDfdisqGlQWpaLlqaLasRpegppslRiTgvgspesgskeeleetgerLakfAeelgvpfef 178
                          Pi++f h+t N+++l+a+eg++rvHiiDfdi+qGlQW  L+q+LasR+++p ++RiTg+g+    sk+ l+etgerLa fAe+l++pfef
  Glyma.05G049300.1.p 365 PIPRFLHFTSNEMLLRAFEGKDRVHIIDFDIKQGLQWSGLFQSLASRSNPPTHVRITGIGE----SKQDLNETGERLAGFAEALNLPFEF 450
                          *************************************************************....9************************ PP

                 GRAS 179 nvlvakrledleleeLrvkpgEalaVnlvlqlhrlldesvsleserdevLklvkslsPkvvvvveqeadhnsesFlerflealeyysalf 268
                          ++ v++rled++l++L+vk++E++aVn+vlqlh++l +    +   +++L l++s++P vvvv+eqea+hn++++  r++++l+yysalf
  Glyma.05G049300.1.p 451 HP-VVDRLEDVRLWMLHVKEHETVAVNCVLQLHKTLYDGSGGA--LRDFLGLIRSTNPSVVVVAEQEAEHNENRLEGRVCNSLKYYSALF 537
                          **.7*******************************95543333..589****************************************** PP

                 GRAS 269 dsl.eaklpreseerikvErellgreivnvvacegaerrerhetlekWrerl.eeaGFkpvplsekaakqaklllrkvksdgyrveee.. 354
                          ds+ e++lp+es  r+k+E++  ++ei+n+vaceg+er+erhe++++Wr+++ e+ GF+ + ++e++ +q ++ll++++ + y+v+++  
  Glyma.05G049300.1.p 538 DSIdESGLPQESAVRVKIEEM-YAKEIRNIVACEGRERVERHESFGNWRRMMvEQGGFRCMGVTERELSQSQMLLKMYSCESYSVKKQek 626
                          ***999***************.899************************99935589**********************999***95533 PP

                 GRAS 355 ..sgslvlgWkdrpLvsvSaW 373
                               ++l W ++pL++vSaW
  Glyma.05G049300.1.p 627 egATGVTLSWLEQPLYTVSAW 647
                          3344566************** PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5098555.458249624IPR005202Transcription factor GRAS
PfamPF035146.3E-125275647IPR005202Transcription factor GRAS
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 665 aa     Download sequence    Send to blast
MLAGCSSSTL LSPRHRLRSE ASAQFQACHF QLPSSMSTQR LDLPCTTTTF TRNNKDTTSS  60
RSVLSVDQKP IEAKTSTCSL KQHIRLPPLA ITAAPSPLVE DSIIKDNTNN NKSLKRLAAE  120
HQDDSFTNNI AKRKKKSSST ECDWFQPDVV GTTLGGFNNN NNNNNTSLAS FSSEEDRVCF  180
VPSEVVSHSA PFPLNPWLES CVTKITNFGE GSHRPHHHHH SDHASGSVSN ASSESQSLRL  240
NDNVSEHEVG NGSGNPYYHH EVDTGEEDNH HGFELVSLLT GCVDAIGSRN VTAINHFIAK  300
LGDLASPKGT TSISRICAYF TEALAIRVTR LWPHVFHITT TTTSRDMVED DESATAMRLL  360
NQVTPIPRFL HFTSNEMLLR AFEGKDRVHI IDFDIKQGLQ WSGLFQSLAS RSNPPTHVRI  420
TGIGESKQDL NETGERLAGF AEALNLPFEF HPVVDRLEDV RLWMLHVKEH ETVAVNCVLQ  480
LHKTLYDGSG GALRDFLGLI RSTNPSVVVV AEQEAEHNEN RLEGRVCNSL KYYSALFDSI  540
DESGLPQESA VRVKIEEMYA KEIRNIVACE GRERVERHES FGNWRRMMVE QGGFRCMGVT  600
ERELSQSQML LKMYSCESYS VKKQEKEGAT GVTLSWLEQP LYTVSAWGPV DAAAGTSSSF  660
SQPS*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5hyz_A2e-4335164774374GRAS family transcription factor containing p
Search in ModeBase
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Gma.392130.0flower| root
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_003525725.10.0PREDICTED: scarecrow-like protein 28
RefseqXP_006579605.10.0PREDICTED: scarecrow-like protein 28
RefseqXP_006579606.10.0PREDICTED: scarecrow-like protein 28
RefseqXP_006579607.10.0PREDICTED: scarecrow-like protein 28
SwissprotQ9CAN30.0SCL28_ARATH; Scarecrow-like protein 28
TrEMBLI1K0D00.0I1K0D0_SOYBN; Uncharacterized protein
STRINGGLYMA05G03490.30.0(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP55071521
FabidsOGEF91613244
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G63100.10.0GRAS family protein