PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Glyma.05G037800.1.p
Common NameGLYMA_05G037800, LOC100815061
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Glycine; Soja
Family Dof
Protein Properties Length: 331aa    MW: 36322.6 Da    PI: 6.8257
Description Dof family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Glyma.05G037800.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-Dof126.39.6e-4053113262
               zf-Dof   2 kekalkcprCdstntkfCyynnyslsqPryfCkaCrryWtkGGalrnvPvGggrrknkkss 62 
                          +e+alkcprC+st+tkfCyynnyslsqPryfCk+CrryWt+GG+lrn+PvGgg+rknkk+s
  Glyma.05G037800.1.p  53 QEQALKCPRCESTHTKFCYYNNYSLSQPRYFCKTCRRYWTQGGTLRNIPVGGGCRKNKKVS 113
                          5799******************************************************976 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
ProDomPD0074786.0E-2751111IPR003851Zinc finger, Dof-type
PfamPF027011.1E-3355111IPR003851Zinc finger, Dof-type
PROSITE profilePS5088429.06857111IPR003851Zinc finger, Dof-type
PROSITE patternPS0136105995IPR003851Zinc finger, Dof-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 331 aa     Download sequence    Send to blast
MGFSSLHVCM DSSDHWMQGT IHEECGVDNS SSPSGEMLPC SRPMTESRLR PPQEQALKCP  60
RCESTHTKFC YYNNYSLSQP RYFCKTCRRY WTQGGTLRNI PVGGGCRKNK KVSTKKHNDQ  120
HQPAVNQNQP HPGPSYLHNH KDLQLPYLDV QFPHLNNLLG TNAGALQGNP SFMESKYNMG  180
MLENPRPIDF MESRLDGMSM IRGSTRSFEL LENSDMSVGG GVGFGDVSGY NGLPLNYQGL  240
SSSAFGGMSL DGSINNVGTY IMDSCQRLML PYDGGDNTLN GSIDVKPNPK LLSLEWQDQG  300
CSDAEKLSLG YLNGSGSWTA YGSSTANPLV *
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Gma.503261e-106meristem| root
Cis-element ? help Back to Top
SourceLink
PlantRegMapGlyma.05G037800.1.p
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankEU0283310.0EU028331.1 Glycine max clone BAC gmw1-89M01 genomic sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_003525503.10.0dof zinc finger protein DOF5.6
RefseqXP_028231515.10.0dof zinc finger protein DOF5.6-like
TrEMBLA0A445KIV20.0A0A445KIV2_GLYSO; Dof zinc finger protein DOF5.6
TrEMBLK7KMQ70.0K7KMQ7_SOYBN; Uncharacterized protein
STRINGGLYMA05G02220.20.0(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF50923456
Representative plantOGRP3817445
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G62940.18e-49Dof family protein