PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Glyma.05G026500.1.p
Common NameGLYMA_05G026500
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Glycine; Soja
Family Nin-like
Protein Properties Length: 300aa    MW: 34929.2 Da    PI: 4.7225
Description Nin-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Glyma.05G026500.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1RWP-RK81.21e-25139186552
               RWP-RK   5 isledlskyFslpikdAAkeLgvclTvLKriCRqyGIkRWPhRkiksl 52 
                          +s +++s+yF++pi++AA+eL+v+ T+LK++CR+ GI+RWPhRk+ sl
  Glyma.05G026500.1.p 139 LSRKTISQYFYMPITQAARELNVGITLLKKRCREVGIRRWPHRKLMSL 186
                          8899*****************************************997 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5151917.757121206IPR003035RWP-RK domain
PfamPF020426.9E-21139186IPR003035RWP-RK domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0051302Biological Processregulation of cell division
Sequence ? help Back to Top
Protein Sequence    Length: 300 aa     Download sequence    Send to blast
MGWSSFYEID EEPFPFTCQF SYSGNSEVYP SLDWPYDFPI QDYYIDAVPL MDYYPSDPLY  60
ETLTTEPTQS VQDYDFYDIK KGLPFWKEVD AVFDSQKVFL FGNNEESGTK KEMMEDGKVN  120
DNRGIEERIS GSSSSCRMLS RKTISQYFYM PITQAARELN VGITLLKKRC REVGIRRWPH  180
RKLMSLQTLI NNVQELGKEE GRESEEKLRS AIEILEREKK VLEEMPDTEL EDTTKRLRQA  240
CFKANYKKRK LTVTGRGREP HSSSFSGFVA RSIVNATGEY SNESEEERDI KYLLSQFLE*
Cis-element ? help Back to Top
SourceLink
PlantRegMapGlyma.05G026500.1.p
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAC2352461e-101AC235246.1 Glycine max strain Williams 82 clone GM_WBb0033G13, complete sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_003525466.10.0protein RKD1
RefseqXP_028234123.10.0protein RKD1-like
TrEMBLA0A0R0JQB70.0A0A0R0JQB7_SOYBN; Uncharacterized protein
TrEMBLA0A445KIH00.0A0A445KIH0_GLYSO; Protein RKD1
STRINGGLYMA05G01030.20.0(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF61843052
Representative plantOGRP5671777
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G18790.19e-47RWP-RK domain-containing protein