PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Glyma.05G019900.1.p
Common NameGLYMA_05G019900, LOC102665855
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Glycine; Soja
Family TCP
Protein Properties Length: 392aa    MW: 43196.7 Da    PI: 10.1177
Description TCP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Glyma.05G019900.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1TCP91.41.9e-2859135379
                  TCP   3 gkkdrhskihTkvggRdRRvRlsaecaarfFdLqdeLGfdkdsktieWLlqqakpaikeltgtssssaseceaesss 79 
                          g kdrhsk++T +g+RdRR+Rls+++a++++ Lqd+LGf ++sk ++WLl++ k  i++l+ +++++  + + +++ 
  Glyma.05G019900.1.p  59 GSKDRHSKVCTIRGLRDRRIRLSVPTAIQLYNLQDKLGFNQPSKVVDWLLEATKSDIDKLPPLQFPHCFAHQFHQQT 135
                          68*************************************************************66655222222222 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5136928.87560118IPR017887Transcription factor TCP subgroup
PfamPF036341.2E-2760155IPR005333Transcription factor, TCP
Sequence ? help Back to Top
Protein Sequence    Length: 392 aa     Download sequence    Send to blast
MMIESSGKVH EAKNQQEGDD DNNIKIEKLL KARPSTSSSS RSWSAFRNPR IVRVSRSLGS  60
KDRHSKVCTI RGLRDRRIRL SVPTAIQLYN LQDKLGFNQP SKVVDWLLEA TKSDIDKLPP  120
LQFPHCFAHQ FHQQTLLPGT SQFSLGGFYD AANNNSTFIK DGGNQNRLTA TKSTRYWDID  180
SLNNGKELAE SVSISQKGQF WIKTNEQENH QGGGIGGSST TTHNREDNSS VHYKLFPIGT  240
TTNNSYLPGL LNNGMTHNSY HHSEPSRLSL SHFGSHGLFP SHDSHQSSGI GVPFSSSNFS  300
GASSGPQLLF CPTSATPSAF YSVESDPRQS NNNVQIFSSS SQVMKRLPLI QSLHSTNSPI  360
SRRLPTSFSS KLLDSDNNDR SQPNKGTSSR S*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5zkt_A3e-1865119155Putative transcription factor PCF6
5zkt_B3e-1865119155Putative transcription factor PCF6
Search in ModeBase
Expression -- Description ? help Back to Top
Source Description
UniprotDEVELOPMENTAL STAGE: Expressed during ovule development (PubMed:25378179). {ECO:0000269|PubMed:25378179}.
UniprotTISSUE SPECIFICITY: Expressed in cotyledons, particularly in the vascular region, in leaves, buds, flowers and immature siliques. {ECO:0000269|PubMed:17307931}.
Functional Description ? help Back to Top
Source Description
UniProtPlays a pivotal role in the control of morphogenesis of shoot organs by negatively regulating the expression of boundary-specific genes such as CUC genes, probably through the induction of miRNA (e.g. miR164). Participates in ovule develpment (PubMed:25378179). {ECO:0000269|PubMed:17307931, ECO:0000269|PubMed:25378179}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapGlyma.05G019900.1.p
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006579499.10.0transcription factor TCP5
RefseqXP_006579500.10.0transcription factor TCP5
RefseqXP_006579501.10.0transcription factor TCP5
RefseqXP_025984413.10.0transcription factor TCP5
RefseqXP_028231294.10.0transcription factor TCP5-like
RefseqXP_028231295.10.0transcription factor TCP5-like
SwissprotQ9FME37e-47TCP5_ARATH; Transcription factor TCP5
TrEMBLA0A445KJ020.0A0A445KJ02_GLYSO; Transcription factor TCP5 isoform A
TrEMBLK7KME00.0K7KME0_SOYBN; Uncharacterized protein
STRINGGLYMA05G00300.20.0(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF93234119
Representative plantOGRP18015163
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G60970.12e-47TEOSINTE BRANCHED 1, cycloidea and PCF transcription factor 5
Publications ? help Back to Top
  1. Koyama T,Sato F,Ohme-Takagi M
    Roles of miR319 and TCP Transcription Factors in Leaf Development.
    Plant Physiol., 2017. 175(2): p. 874-885
    [PMID:28842549]