PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Glyma.05G018100.1.p
Common NameGLYMA_05G018100, LOC100800458
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Glycine; Soja
Family Dof
Protein Properties Length: 293aa    MW: 31922.9 Da    PI: 7.1183
Description Dof family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Glyma.05G018100.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-Dof125.51.7e-392585262
               zf-Dof  2 kekalkcprCdstntkfCyynnyslsqPryfCkaCrryWtkGGalrnvPvGggrrknkkss 62
                         +++alkcprCds ntkfCyynny+lsqPr+fCk+CrryWtkGG lrnvPvGgg+rk+k+ss
  Glyma.05G018100.1.p 25 SQQALKCPRCDSLNTKFCYYNNYNLSQPRHFCKNCRRYWTKGGVLRNVPVGGGCRKSKRSS 85
                         6899******************************************************986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
ProDomPD0074784.0E-262479IPR003851Zinc finger, Dof-type
PfamPF027011.8E-332783IPR003851Zinc finger, Dof-type
PROSITE profilePS5088429.732983IPR003851Zinc finger, Dof-type
PROSITE patternPS0136103167IPR003851Zinc finger, Dof-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0044212Molecular Functiontranscription regulatory region DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 293 aa     Download sequence    Send to blast
MQEIHTMGGG RFFSGDRRLR PHHQSQQALK CPRCDSLNTK FCYYNNYNLS QPRHFCKNCR  60
RYWTKGGVLR NVPVGGGCRK SKRSSKPTKT SSQTASPDPD HHNNNTNSHS SSGSSSLTAA  120
AATATTTTTT EAVSAPETLN LDSNNNNNNM QESKLLIPAL ETNPLEHGTG DCGGIFSEIG  180
PFTSLITTTT STNEPLAFGF GNSTLPDASS FQWLHQKVSS SSNEELKLPE SSLLDHTVDF  240
HSKISHGGGF GSLDWQGGAD QGLFDLPNTV DHAYWSHTHW SDHDNSTLFH LP*
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Gma.290080.0flower
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00570DAPTransfer from AT5G60850Download
Motif logo
Cis-element ? help Back to Top
SourceLink
PlantRegMapGlyma.05G018100.1.p
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMap-Retrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankDQ8572540.0DQ857254.1 Glycine max Dof4 mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_014630893.10.0dof zinc finger protein DOF5.4
RefseqXP_028231265.10.0dof zinc finger protein DOF5.4-like
TrEMBLA0A445KHZ90.0A0A445KHZ9_GLYSO; Dof zinc finger protein DOF5.4
TrEMBLI1K1580.0I1K158_SOYBN; Uncharacterized protein
STRINGGLYMA05G07460.10.0(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF59983050
Representative plantOGRP3817445
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G60850.15e-49OBF binding protein 4