PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Glyma.05G017400.1.p
Common NameGLYMA_05G017400, LOC102664001
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Glycine; Soja
Family bZIP
Protein Properties Length: 215aa    MW: 24404.3 Da    PI: 8.0585
Description bZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Glyma.05G017400.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1bZIP_144.43.6e-14107166463
                          XCHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
               bZIP_1   4 lkrerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkkeleelkkevaklksev 63 
                          +++ +r+ +NRe+ArrsR RKk++ie L+  v++L++ N++L +++  l +  ++  +++
  Glyma.05G017400.1.p 107 DRKKKRMFSNRESARRSRMRKKQQIEVLQYHVDNLQTLNHQLSQKIIYLLECNQQIHQQN 166
                          7899***************************************99977777777666665 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM003388.1E-13104168IPR004827Basic-leucine zipper domain
PROSITE profilePS5021710.231106169IPR004827Basic-leucine zipper domain
Gene3DG3DSA:1.20.5.1701.5E-12108165No hitNo description
PfamPF001701.1E-11108166IPR004827Basic-leucine zipper domain
SuperFamilySSF579599.38E-11108164No hitNo description
CDDcd147025.12E-13109157No hitNo description
PROSITE patternPS000360111126IPR004827Basic-leucine zipper domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 215 aa     Download sequence    Send to blast
MECNEDDELH VAPYASLTQR LHYHSPTQKP IFTSTNLLNV EAGEGHNLNH MDPPHCLHHT  60
PFYCSQFQLP SNSNNPIQIP LHKPSPNISS NNNNNNNSDE AKALLDDRKK KRMFSNRESA  120
RRSRMRKKQQ IEVLQYHVDN LQTLNHQLSQ KIIYLLECNQ QIHQQNAQLK EKVFSLQVAL  180
SDLLATSGSA EQPHLIPNGF LAESSTRPIA SSRT*
Cis-element ? help Back to Top
SourceLink
PlantRegMapGlyma.05G017400.1.p
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006579708.11e-157basic leucine zipper 43
TrEMBLK7KNF61e-156K7KNF6_SOYBN; Uncharacterized protein
STRINGGLYMA05G07522.11e-157(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF130442430
Representative plantOGRP1181045
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G60830.15e-26basic leucine-zipper 70