PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Glyma.04G251900.1.p
Common NameGLYMA_04G251900, LOC100787926
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Glycine; Soja
Family GRAS
Protein Properties Length: 503aa    MW: 55183.7 Da    PI: 6.1558
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Glyma.04G251900.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS329.56.4e-1011074972374
                 GRAS   2 velLlecAeavss..gdlelaqalLarlsel....aspdgdpmqRlaayfteALaarlarsv........selykalppsetsekn.... 73 
                          v+lL+++Aea++   ++  la+ +L rl+el    a p+g++m+Rlaayft AL+  l + +        ++ y+++++      +    
  Glyma.04G251900.1.p 107 VHLLMAAAEALTGapKSRDLARVILVRLKELvshaAPPHGSNMERLAAYFTDALQGLLEGASggahnnkrHHHYNIITS------Scgph 190
                          79*********98556777*********998666577999*****************9873311111111334444422......02222 PP

                 GRAS  74 ........sseelaalklfsevsPilkfshltaNqaIleavegeervHiiDfdisqGlQWpaLlqaLasRpegpp..slRiTgvgspesg 153
                                  +s++laa++l++++sP++kf+h+taNqaIle+v++e+rvHi+D+di++G+QW++L+qaLas + gpp  +lRiT++++  sg
  Glyma.04G251900.1.p 191 hrddhhnhQSNTLAAFQLLQDMSPYVKFGHFTANQAILESVAHERRVHIVDYDIMEGVQWASLMQALASNKTGPPgpHLRITALSRTGSG 280
                          2334566799999999****************************************************999776656*********8888 PP

                 GRAS 154 ..skeeleetgerLakfAeelgvpfefnvlvakrledleleeLrvkpgEalaVnlvlqlhrlldesvsleserdevLklvkslsPkvvvv 241
                            s  +++etg+rL+ fA++lg pf+f+    +  e++++++L++ +gEal+ n++l+l +l  +  ++     ++L+  k l+P++v++
  Glyma.04G251900.1.p 281 rrSIATVQETGRRLTAFAASLGQPFSFHHCRLDPDETFKPSSLKLVRGEALVFNCMLNLPHLSYRAPDSVA---SFLSGAKALKPRLVTL 367
                          99999************************9999****************************9855555555...9*************** PP

                 GRAS 242 veqeadhnsesFlerflealeyysalfdsleaklpreseerikvErellgreivnvvacegaerrerhetlekWrerleeaGFkpvplse 331
                          ve+e+  +++ F+ rf+e+l++ysa+fdslea++p + ++r+ vEr+++g++iv  +    +     +e+ ++W e+l++aGF+ vp+s 
  Glyma.04G251900.1.p 368 VEEEVGSSAGGFVGRFMESLHHYSAVFDSLEAGFPMQGRARALVERVFFGPRIVGSLGRLYRT---GEEERGSWGEWLGAAGFRGVPMSF 454
                          *****************************************************9999988887...677789****************** PP

                 GRAS 332 kaakqaklllrkvksdgyrveee.sgslvlgWkdrpLvsvSaWr 374
                           + +qakll+  ++ dgyrvee   + lvl Wk+r+L+s+S W+
  Glyma.04G251900.1.p 455 ANHCQAKLLIGLFN-DGYRVEELgTNKLVLDWKSRRLLSASLWT 497
                          **************.******98689999**************6 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5098551.26580477IPR005202Transcription factor GRAS
PfamPF035142.2E-98107497IPR005202Transcription factor GRAS
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 503 aa     Download sequence    Send to blast
MEIDMDMDFS GYSTITNTIP SSDDDYGCNW NHWSPVVNWD AFTGAHDDFH HLIDSIMCDS  60
AAAEEDNLSP DDHAASNSPS ASVTEEEDDD ADEETGPVDD SKGLRVVHLL MAAAEALTGA  120
PKSRDLARVI LVRLKELVSH AAPPHGSNME RLAAYFTDAL QGLLEGASGG AHNNKRHHHY  180
NIITSSCGPH HRDDHHNHQS NTLAAFQLLQ DMSPYVKFGH FTANQAILES VAHERRVHIV  240
DYDIMEGVQW ASLMQALASN KTGPPGPHLR ITALSRTGSG RRSIATVQET GRRLTAFAAS  300
LGQPFSFHHC RLDPDETFKP SSLKLVRGEA LVFNCMLNLP HLSYRAPDSV ASFLSGAKAL  360
KPRLVTLVEE EVGSSAGGFV GRFMESLHHY SAVFDSLEAG FPMQGRARAL VERVFFGPRI  420
VGSLGRLYRT GEEERGSWGE WLGAAGFRGV PMSFANHCQA KLLIGLFNDG YRVEELGTNK  480
LVLDWKSRRL LSASLWTQIN SF*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5hyz_A9e-5013849629374GRAS family transcription factor containing p
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_003522584.10.0PREDICTED: nodulation-signaling pathway 2 protein
SwissprotQ5NE240.0NSP2_MEDTR; Nodulation-signaling pathway 2 protein
TrEMBLI1JZ900.0I1JZ90_SOYBN; Uncharacterized protein
STRINGGLYMA04G43090.10.0(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP68391319
FabidsOGEF62643152
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G08250.11e-161GRAS family protein