PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Glyma.04G239500.1.p
Common NameGLYMA_04G239500, LOC778117
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Glycine; Soja
Family Dof
Protein Properties Length: 290aa    MW: 31989.2 Da    PI: 4.6439
Description Dof family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Glyma.04G239500.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-Dof120.37.2e-384499661
               zf-Dof  6 lkcprCdstntkfCyynnyslsqPryfCkaCrryWtkGGalrnvPvGggrrknkks 61
                          +cprC stntkfCyynnyslsqPryfCk+CrryWtkGG+lrnvPvGgg+rkn++ 
  Glyma.04G239500.1.p 44 PNCPRCASTNTKFCYYNNYSLSQPRYFCKGCRRYWTKGGSLRNVPVGGGCRKNRRG 99
                         68***************************************************986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
ProDomPD0074786.0E-243589IPR003851Zinc finger, Dof-type
PROSITE profilePS5088428.7054498IPR003851Zinc finger, Dof-type
PfamPF027015.4E-324498IPR003851Zinc finger, Dof-type
PROSITE patternPS0136104682IPR003851Zinc finger, Dof-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 290 aa     Download sequence    Send to blast
MFPRSFNISG GDAGLPQMLH PRHMVTPMEE QQRSRWKPSV EVAPNCPRCA STNTKFCYYN  60
NYSLSQPRYF CKGCRRYWTK GGSLRNVPVG GGCRKNRRGK SSSSSRLQHQ SHQRAFSCEN  120
TESSSVGDDA QQNNNVSRDI DMALVFAKFL NPKPTTGEDN NGSPSSNNYL TPESVEIEND  180
AVVQSQNKAS SDPVIVESEN LSLVEIDELE RLLGVCGDED GLWSDATLSS SVTWEPPLKE  240
SEYSMPLNED DGDQLLPIII SASTMSDTCW SNWSSFDLST MDALSSSPS*
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Gma.618300.0epicotyl
Cis-element ? help Back to Top
SourceLink
PlantRegMapGlyma.04G239500.1.p
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankDQ8572741e-168DQ857274.1 Glycine max Dof23 mRNA, partial cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_003522553.10.0dof zinc finger protein DOF3.5
RefseqXP_028227101.10.0dof zinc finger protein DOF3.5-like
TrEMBLA0A445L4M50.0A0A445L4M5_GLYSO; Dof zinc finger protein DOF3.5
TrEMBLK7KLZ80.0K7KLZ8_SOYBN; Uncharacterized protein
STRINGGLYMA04G41830.20.0(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF18173394
Representative plantOGRP3817445
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G52440.17e-36Dof family protein